Os04t0395600-01

Locus

Os04g0395600

Description

Auxin receptor, Flag leaf inclination, Primary root growth, Crown root initiation, Seed development, Tillering

RAP-DB Gene Symbol Synonym(s)

OsAFB2, OsAFB2-1

RAP-DB Gene Name Synonym(s)

AUXIN SIGNALING F-BOX 2, Auxin signaling f-box 2

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsAFB2, ABF2, OsAFB2-1, OsAFB2-2, OsFbox206, Os_F0492

Oryzabase Gene Name Synonym(s)

Auxin signaling f-box 2, Auxin F-box protein 2, F-box protein 206

Transcript Evidence

AK072338

Protein Evidence

Q7XVM8

Literature

PMID: 22846038

PMID: 22253868

Note

Manual Curation

December 12, 2017

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

F-box-like domain superfamily (IPR036047)

Leucine-rich repeat domain superfamily (IPR032675)

F-box domain (IPR001810)

Leucine-rich repeat, cysteine-containing subtype (IPR006553)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J023042B17 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0395600-01)

RiceXPro (AK072338)

Others

Oryzabase (9793)

KEGG (Os04t0395600-01)

Transcript

2959 bp

>Os04t0395600-01 Auxin receptor, Flag leaf inclination, Primary root growth, Crown root initiation, Seed development, Tillering
ACCCCCACCACCACCACTCTCCCCGCCTCCGCCTCCGCCTCCGCCGCCGCCGCCGCCGTC
CTCCTCTTCTCGCGGTCGCTGCGTCCTCGCCTCGGGGCTCGGCCCGTGCTGCCGCCGTTA
CGCGTGGGCTGATTTCCTCCTCGCTTCCACGTACGCCATCTAGGAAGAGGACGGTTGCGC
GCGCGGCGGCGGCGCGGCGCGTGATCTCCGCCGGGGGAGGAGGAGGAGGCGGGGGTTGAT
GGGTTAGATCTGGCGGTTTCCGGGCGGCGTGGATCTGAAACCGTGGTGGAGGTGGTTTGG
TTTCGGTTCGGGGAGGTCGCCATCGTTGCTCCTCGTTTTGGCCTTGTGCCCATTTGGAGT
CAGCCAGCTCGTGTGCGGGGAGGAAGCCTCTCATGTCCAAAATAGGGGCATGGGTGTCGG
ATGCGGTAACTGCCCCCCTGTTGCTTCGCTTCCTTCCAGATCTGAAACCCATGTGAATGC
TGCTCCTGCTGCTACTTTGAGATAGAGCATTGCGTGTTCTTGGATTGGTGGATGATGAGG
TGAAAGTGAAGAGGGGGAGAGTGTGTTTCCTGTTTGTGAGAGATTTTTTTCTCTGAATAA
ACCTGGAGCCGTGGAGGAGGAAGCAGATCCTATCGTGTAGCTCCCGCGGCGGCGGCTGCG
GTGGTGGTGGGGAAGAGGAAGAAGAAGGCGGTGGCGGCGGCGGAGCCATGACGTACTTCC
CGGAGGAGGTGGTGGAGCACATCTTCAGCTTCCTGCCGGCGCAGCGCGACCGCAACACGG
TCTCGCTCGTCTGCAAGGTGTGGTACGAGATCGAGAGGCTGAGCCGCCGCGGCGTCTTCG
TGGGCAACTGCTACGCCGTGCGCGCCGGCCGCGTCGCCGCGCGGTTCCCCAACGTGCGGG
CGCTCACGGTGAAGGGGAAGCCCCACTTCGCCGACTTCAACCTCGTGCCCCCCGACTGGG
GCGGCTACGCGGGGCCGTGGATCGAGGCGGCCGCGAGGGGATGCCACGGCCTGGAGGAGC
TCAGGATGAAGCGGATGGTGGTGTCCGACGAGAGCCTCGAGCTGCTGGCTCGCTCGTTCC
CGCGGTTCAGGGCTCTTGTTCTTATCAGCTGCGAGGGGTTCAGCACTGACGGGCTAGCCG
CCGTCGCGAGCCATTGCAAGCTTCTGAGGGAGTTGGATTTGCAGGAAAATGAAGTGGAGG
ATCGAGGGCCTAGGTGGCTTTCCTGCTTCCCTGATTCCTGCACATCACTTGTCTCATTGA
ATTTTGCCTGCATCAAAGGGGAGGTTAATGCTGGTTCACTGGAGAGACTTGTTAGCAGGT
CCCCAAACCTGCGGAGTTTGAGGCTGAATCGATCTGTATCGGTAGATACACTTGCAAAGA
TACTACTGCGTACCCCTAACTTGGAGGATTTGGGGACAGGGAATTTGACAGATGACTTCC
AAACTGAGTCCTACTTTAAGCTTACCAGTGCTCTGGAGAAATGCAAGATGTTGAGGAGTT
TGTCTGGATTCTGGGATGCTTCTCCTGTTTGCCTGTCATTTATCTACCCCCTGTGTGCTC
AACTGACAGGATTGAACTTGAGCTATGCCCCCACACTTGATGCTTCTGACCTTACAAAAA
TGATTAGCCGCTGTGTGAAGCTCCAACGCCTTTGGGTACTGGATTGTATCTCGGACAAAG
GCTTGCAAGTGGTGGCCTCCAGTTGCAAAGACTTGCAAGAACTCAGGGTATTTCCATCAG
ATTTCTACGTAGCTGGTTATTCTGCAGTGACAGAGGAGGGACTTGTTGCAGTATCCTTGG
GCTGTCCAAAACTGAACTCACTACTGTACTTCTGTCACCAAATGACTAATGCTGCACTAG
TTACTGTCGCCAAGAACTGTCCAAATTTCACACGATTCAGACTTTGTATTCTTGAGCCAG
GGAAGCCTGATGTTGTGACAAGCCAACCATTAGATGAAGGCTTTGGAGCTATTGTTCGTG
AGTGCAAGGGATTACAACGTTTGTCAATATCTGGTCTTCTCACAGACAAAGTTTTCATGT
ATATTGGGAAATATGCAAAACAACTTGAGATGCTTTCTATAGCATTTGCTGGTGACAGTG
ATAAGGGTATGATGCATGTTATGAATGGATGCAAGAATTTAAGGAAACTGGAGATAAGAG
ATAGCCCGTTTGGTGATGCTGCACTCTTGGGGAATTTTGCTAGGTACGAGACAATGCGAT
CCCTTTGGATGTCATCTTGCAATGTCACGTTAAAGGGGTGCCAAGTCCTTGCGTCAAAGA
TGCCGATGCTCAATGTTGAGGTCATAAATGAGCGGGATGGTAGCAATGAAATGGAGGAAA
ACCATGGAGATCTGCCTAAAGTGGAGAAATTATATGTGTACCGCACAACTGCTGGGGCGA
GGGATGATGCACCAAATTTTGTTAAAATCCTATAGAGCTAGCTGAGAGTAGCAAGGAATC
CTCTTATTCCATAAGATGGTCGGCGGAATCTGGGAGGAGGCCGGGGCCGCGGCAACAGTG
GTAAGCTCTTCAAGTGTCTCCTCCTCTCCTTTGCAGGGACAGGAAAAACCACGTTGGTGT
GCCTCCCTTATCTCGGAGCATCTGGCCTGGGATCATCATCCATCATCCCCCCGTTTCGCC
TTTTAGCCCGTTTGGTCATACCGACGAGGCCCTTATCCTGTTGTGCAATTCTGAGCAAGC
TCAGGACCACCACCAATCCATCATGTTAGCTCGACCTTTTCTCTCTTCTTCCCTTTATTA
TTTTTTCTTCTTTTTTTACCTTGTGTAATATGTAGAACCCACTTCCATTTGCTTTTGACA
TTTGCCACAGCGGATTGTGCTGCTGCTGGTTGTAATGCTTGTTTTCAAGCCTCCTGACCG
GGACGTTTCGGGGACGATGATTAGTTTCCTTCTCTTTGCTCCTGTGAATGCAGTCAGTGC
CTGGAATAATTTCTGCTTC

CDS

1728 bp

>Os04t0395600-01 Auxin receptor, Flag leaf inclination, Primary root growth, Crown root initiation, Seed development, Tillering
ATGACGTACTTCCCGGAGGAGGTGGTGGAGCACATCTTCAGCTTCCTGCCGGCGCAGCGC
GACCGCAACACGGTCTCGCTCGTCTGCAAGGTGTGGTACGAGATCGAGAGGCTGAGCCGC
CGCGGCGTCTTCGTGGGCAACTGCTACGCCGTGCGCGCCGGCCGCGTCGCCGCGCGGTTC
CCCAACGTGCGGGCGCTCACGGTGAAGGGGAAGCCCCACTTCGCCGACTTCAACCTCGTG
CCCCCCGACTGGGGCGGCTACGCGGGGCCGTGGATCGAGGCGGCCGCGAGGGGATGCCAC
GGCCTGGAGGAGCTCAGGATGAAGCGGATGGTGGTGTCCGACGAGAGCCTCGAGCTGCTG
GCTCGCTCGTTCCCGCGGTTCAGGGCTCTTGTTCTTATCAGCTGCGAGGGGTTCAGCACT
GACGGGCTAGCCGCCGTCGCGAGCCATTGCAAGCTTCTGAGGGAGTTGGATTTGCAGGAA
AATGAAGTGGAGGATCGAGGGCCTAGGTGGCTTTCCTGCTTCCCTGATTCCTGCACATCA
CTTGTCTCATTGAATTTTGCCTGCATCAAAGGGGAGGTTAATGCTGGTTCACTGGAGAGA
CTTGTTAGCAGGTCCCCAAACCTGCGGAGTTTGAGGCTGAATCGATCTGTATCGGTAGAT
ACACTTGCAAAGATACTACTGCGTACCCCTAACTTGGAGGATTTGGGGACAGGGAATTTG
ACAGATGACTTCCAAACTGAGTCCTACTTTAAGCTTACCAGTGCTCTGGAGAAATGCAAG
ATGTTGAGGAGTTTGTCTGGATTCTGGGATGCTTCTCCTGTTTGCCTGTCATTTATCTAC
CCCCTGTGTGCTCAACTGACAGGATTGAACTTGAGCTATGCCCCCACACTTGATGCTTCT
GACCTTACAAAAATGATTAGCCGCTGTGTGAAGCTCCAACGCCTTTGGGTACTGGATTGT
ATCTCGGACAAAGGCTTGCAAGTGGTGGCCTCCAGTTGCAAAGACTTGCAAGAACTCAGG
GTATTTCCATCAGATTTCTACGTAGCTGGTTATTCTGCAGTGACAGAGGAGGGACTTGTT
GCAGTATCCTTGGGCTGTCCAAAACTGAACTCACTACTGTACTTCTGTCACCAAATGACT
AATGCTGCACTAGTTACTGTCGCCAAGAACTGTCCAAATTTCACACGATTCAGACTTTGT
ATTCTTGAGCCAGGGAAGCCTGATGTTGTGACAAGCCAACCATTAGATGAAGGCTTTGGA
GCTATTGTTCGTGAGTGCAAGGGATTACAACGTTTGTCAATATCTGGTCTTCTCACAGAC
AAAGTTTTCATGTATATTGGGAAATATGCAAAACAACTTGAGATGCTTTCTATAGCATTT
GCTGGTGACAGTGATAAGGGTATGATGCATGTTATGAATGGATGCAAGAATTTAAGGAAA
CTGGAGATAAGAGATAGCCCGTTTGGTGATGCTGCACTCTTGGGGAATTTTGCTAGGTAC
GAGACAATGCGATCCCTTTGGATGTCATCTTGCAATGTCACGTTAAAGGGGTGCCAAGTC
CTTGCGTCAAAGATGCCGATGCTCAATGTTGAGGTCATAAATGAGCGGGATGGTAGCAAT
GAAATGGAGGAAAACCATGGAGATCTGCCTAAAGTGGAGAAATTATATGTGTACCGCACA
ACTGCTGGGGCGAGGGATGATGCACCAAATTTTGTTAAAATCCTATAG

Protein

576 aa

>Os04t0395600-01 Auxin receptor, Flag leaf inclination, Primary root growth, Crown root initiation, Seed development, Tillering
MTYFPEEVVEHIFSFLPAQRDRNTVSLVCKVWYEIERLSRRGVFVGNCYAVRAGRVAARF
PNVRALTVKGKPHFADFNLVPPDWGGYAGPWIEAAARGCHGLEELRMKRMVVSDESLELL
ARSFPRFRALVLISCEGFSTDGLAAVASHCKLLRELDLQENEVEDRGPRWLSCFPDSCTS
LVSLNFACIKGEVNAGSLERLVSRSPNLRSLRLNRSVSVDTLAKILLRTPNLEDLGTGNL
TDDFQTESYFKLTSALEKCKMLRSLSGFWDASPVCLSFIYPLCAQLTGLNLSYAPTLDAS
DLTKMISRCVKLQRLWVLDCISDKGLQVVASSCKDLQELRVFPSDFYVAGYSAVTEEGLV
AVSLGCPKLNSLLYFCHQMTNAALVTVAKNCPNFTRFRLCILEPGKPDVVTSQPLDEGFG
AIVRECKGLQRLSISGLLTDKVFMYIGKYAKQLEMLSIAFAGDSDKGMMHVMNGCKNLRK
LEIRDSPFGDAALLGNFARYETMRSLWMSSCNVTLKGCQVLASKMPMLNVEVINERDGSN
EMEENHGDLPKVEKLYVYRTTAGARDDAPNFVKIL*

5'UTR

chr04:19457915..19458208 (- strand) : 294 bp

chr04:19457365..19457777 (- strand) : 413 bp

CDS

chr04:19456913..19457364 (- strand) : 452 bp

chr04:19455807..19456302 (- strand) : 496 bp

chr04:19454926..19455705 (- strand) : 780 bp

3'UTR

chr04:19454886..19454925 (- strand) : 40 bp

chr04:19453774..19454257 (- strand) : 484 bp

FASTA

>Os04t0395600-01 class=Sequence position=chr04:19453774..19458208 (- strand)
ACCCCCACCA CCACCACTCT CCCCGCCTCC GCCTCCGCCT CCGCCGCCGC CGCCGCCGTC CTCCTCTTCT CGCGGTCGCT
GCGTCCTCGC CTCGGGGCTC GGCCCGTGCT GCCGCCGTTA CGCGTGGGCT GATTTCCTCC TCGCTTCCAC GTACGCCATC
TAGGAAGAGG ACGGTTGCGC GCGCGGCGGC GGCGCGGCGC GTGATCTCCG CCGGGGGAGG AGGAGGAGGC GGGGGTTGAT
GGGTTAGATC TGGCGGTTTC CGGGCGGCGT GGATCTGAAA CCGTGGTGGA GGTGGTAGGT TTTTTCGTTC GCGGATTCCT
TTTTGCTGTT CTGCTCGTTT CCATTTTCTC GCAAGCGGAG ATTGGAGCTG GAGCTGACGA GGTGTGGTGT TGGGTGTGGG
GGTTTTTTCC TCGCTGATCT CGTGCATGCA GGTTTGGTTT CGGTTCGGGG AGGTCGCCAT CGTTGCTCCT CGTTTTGGCC
TTGTGCCCAT TTGGAGTCAG CCAGCTCGTG TGCGGGGAGG AAGCCTCTCA TGTCCAAAAT AGGGGCATGG GTGTCGGATG
CGGTAACTGC CCCCCTGTTG CTTCGCTTCC TTCCAGATCT GAAACCCATG TGAATGCTGC TCCTGCTGCT ACTTTGAGAT
AGAGCATTGC GTGTTCTTGG ATTGGTGGAT GATGAGGTGA AAGTGAAGAG GGGGAGAGTG TGTTTCCTGT TTGTGAGAGA
TTTTTTTCTC TGAATAAACC TGGAGCCGTG GAGGAGGAAG CAGATCCTAT CGTGTAGCTC CCGCGGCGGC GGCTGCGGTG
GTGGTGGGGA AGAGGAAGAA GAAGGCGGTG GCGGCGGCGG AGCCATGACG TACTTCCCGG AGGAGGTGGT GGAGCACATC
TTCAGCTTCC TGCCGGCGCA GCGCGACCGC AACACGGTCT CGCTCGTCTG CAAGGTGTGG TACGAGATCG AGAGGCTGAG
CCGCCGCGGC GTCTTCGTGG GCAACTGCTA CGCCGTGCGC GCCGGCCGCG TCGCCGCGCG GTTCCCCAAC GTGCGGGCGC
TCACGGTGAA GGGGAAGCCC CACTTCGCCG ACTTCAACCT CGTGCCCCCC GACTGGGGCG GCTACGCGGG GCCGTGGATC
GAGGCGGCCG CGAGGGGATG CCACGGCCTG GAGGAGCTCA GGATGAAGCG GATGGTGGTG TCCGACGAGA GCCTCGAGCT
GCTGGCTCGC TCGTTCCCGC GGTTCAGGGC TCTTGTTCTT ATCAGCTGCG AGGGGTTCAG CACTGACGGG CTAGCCGCCG
TCGCGAGCCA TTGCAAGTGA GTGCTTCAGA TTCTTTTATG TTTCAATCGC TGCTGTGAGC TTGTGATATT CTTCTCTGCT
TTGGCAATGT AGTTTGTAGT TGCATACTCT CTGCAGTTTA GAGTTGAATG GATCGATTTT GATCTGTTGA ATTTCATACA
TCTTTTAGCT ACAGGTTCTT GCTAATCATA GAACATAGGG GGTTAGGGGG GACCTTTGCA GTGTTTGAAG GAACAAGATG
CATCTGGCAT TTCTATATTC TGTTCGAACT TTGTTTTACA TCGAGGCATT CATCTTCTGT GATGTTTCAT TGTGTTCTTT
TTTACTTGTA CAGAGCAATT CTAAATTGAA GTGCATGTGA TTATTACCAC TTCCATTATT GGCTTTCTTC TGTGATTGTT
GTTTACTAGA TGAATTGGTA TTCTTGTGGC CGTTGTTCTA TATTGAACCA ACTGGCATGA GCTTTATTGT TGTGGCCATT
TTCTTTAGAC TACTTGCTAG GGATGGATGC AAATTCTGTT TAGGTTACTG AATAACTTAC TGTTGCTTTG GTTTTAATTT
GTTATGGTTA CACTCATTTT TATGGCTTAT ATGCTGACAC TGTTTTCTTC TCTTTCTGTT GCCTAGGCTT CTGAGGGAGT
TGGATTTGCA GGAAAATGAA GTGGAGGATC GAGGGCCTAG GTGGCTTTCC TGCTTCCCTG ATTCCTGCAC ATCACTTGTC
TCATTGAATT TTGCCTGCAT CAAAGGGGAG GTTAATGCTG GTTCACTGGA GAGACTTGTT AGCAGGTCCC CAAACCTGCG
GAGTTTGAGG CTGAATCGAT CTGTATCGGT AGATACACTT GCAAAGATAC TACTGCGTAC CCCTAACTTG GAGGATTTGG
GGACAGGGAA TTTGACAGAT GACTTCCAAA CTGAGTCCTA CTTTAAGCTT ACCAGTGCTC TGGAGAAATG CAAGATGTTG
AGGAGTTTGT CTGGATTCTG GGATGCTTCT CCTGTTTGCC TGTCATTTAT CTACCCCCTG TGTGCTCAAC TGACAGGATT
GAACTTGAGC TATGCCCCCA CACTTGATGC TTCTGACCTT ACAAAAATGA TTAGCCGCTG TGTGAAGCTC CAACGCCTTT
GGGTGAGTTC CCTTGTTGGT TTGTACTTAT TCTTGTTTGT TGTTGTTGTT GTTGCCCTTT GGTAATATCA AGCAAGTAAC
GGTATTGAGC CTTTATATTG CAGGTACTGG ATTGTATCTC GGACAAAGGC TTGCAAGTGG TGGCCTCCAG TTGCAAAGAC
TTGCAAGAAC TCAGGGTATT TCCATCAGAT TTCTACGTAG CTGGTTATTC TGCAGTGACA GAGGAGGGAC TTGTTGCAGT
ATCCTTGGGC TGTCCAAAAC TGAACTCACT ACTGTACTTC TGTCACCAAA TGACTAATGC TGCACTAGTT ACTGTCGCCA
AGAACTGTCC AAATTTCACA CGATTCAGAC TTTGTATTCT TGAGCCAGGG AAGCCTGATG TTGTGACAAG CCAACCATTA
GATGAAGGCT TTGGAGCTAT TGTTCGTGAG TGCAAGGGAT TACAACGTTT GTCAATATCT GGTCTTCTCA CAGACAAAGT
TTTCATGTAT ATTGGGAAAT ATGCAAAACA ACTTGAGATG CTTTCTATAG CATTTGCTGG TGACAGTGAT AAGGGTATGA
TGCATGTTAT GAATGGATGC AAGAATTTAA GGAAACTGGA GATAAGAGAT AGCCCGTTTG GTGATGCTGC ACTCTTGGGG
AATTTTGCTA GGTACGAGAC AATGCGATCC CTTTGGATGT CATCTTGCAA TGTCACGTTA AAGGGGTGCC AAGTCCTTGC
GTCAAAGATG CCGATGCTCA ATGTTGAGGT CATAAATGAG CGGGATGGTA GCAATGAAAT GGAGGAAAAC CATGGAGATC
TGCCTAAAGT GGAGAAATTA TATGTGTACC GCACAACTGC TGGGGCGAGG GATGATGCAC CAAATTTTGT TAAAATCCTA
TAGAGCTAGC TGAGAGTAGC AAGGAATCCT CTTATTCCAT AAGGTAACCC CTTTCAATAC ATTATTTTCA AAGTGCCTTT
CTATAGTTAA TGAGTTTGCC TGTTACTCTG TTAGCCTATT AATACTAGTG CTGTTTGAAC TTGCATCGTT TTTTTTTTGT
ACCTTGGCTC GTTTTGGTCA CTAGATCCTT TTATTCTCAT TGCATGCCCC ATTGCCTCTC AACATGAAAA CTAGGAGTAT
CTGGTGGCTC TTGTAGCTCA CTCTGTTCAG ATATAATTTG CTTAGCTCAG GACTGACTTT GAACGATTCA TGTCAGCCTG
CATTTTTTTT TCCAAGATAA AATTAACAGT TTATCCTTAA ACTTCTATAC AAAATCAATT CTGCATGAGG AAGCTTCTGC
TATGATAAAA TCCAAAGTGT AAATTAAGGC TGATTCCTGA AAAGATTGAA CTGGGTATAA TAGTACTTGC AACATGATGC
TTTGAGCAAA CCTTTATTCT GCGTCAATCT TTATCCACTC TTTTTGTTTT CTTTCCGCCC CCGGTACAGA TCGTAGCTAC
TCATAGCTCT AAAATTCCCC TCAACGCGAT TGTTACCGTT CAGTTTGGGA TAGGGGGCTT TGCCAGATGA GCATGAGCCC
CCATCTAACC CCCACTCGAT TGCTCTTGCA GATGGTCGGC GGAATCTGGG AGGAGGCCGG GGCCGCGGCA ACAGTGGTAA
GCTCTTCAAG TGTCTCCTCC TCTCCTTTGC AGGGACAGGA AAAACCACGT TGGTGTGCCT CCCTTATCTC GGAGCATCTG
GCCTGGGATC ATCATCCATC ATCCCCCCGT TTCGCCTTTT AGCCCGTTTG GTCATACCGA CGAGGCCCTT ATCCTGTTGT
GCAATTCTGA GCAAGCTCAG GACCACCACC AATCCATCAT GTTAGCTCGA CCTTTTCTCT CTTCTTCCCT TTATTATTTT
TTCTTCTTTT TTTACCTTGT GTAATATGTA GAACCCACTT CCATTTGCTT TTGACATTTG CCACAGCGGA TTGTGCTGCT
GCTGGTTGTA ATGCTTGTTT TCAAGCCTCC TGACCGGGAC GTTTCGGGGA CGATGATTAG TTTCCTTCTC TTTGCTCCTG
TGAATGCAGT CAGTGCCTGG AATAATTTCT GCTTC

Locus: Os04g0395600

Loading...

Locus: Os04g0395600

Loading...