Os04t0395600-02

Locus

Os04g0395600

Description

Auxin receptor, Flag leaf inclination, Primary root growth, Crown root initiation, Seed development, Tillering

RAP-DB Gene Symbol Synonym(s)

OsAFB2, OsAFB2-2

RAP-DB Gene Name Synonym(s)

AUXIN SIGNALING F-BOX 2, Auxin signaling f-box 2

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsAFB2, ABF2, OsAFB2-1, OsAFB2-2, OsFbox206, Os_F0492

Oryzabase Gene Name Synonym(s)

Auxin signaling f-box 2, Auxin F-box protein 2, F-box protein 206

Transcript Evidence

AK100862

Protein Evidence

Q7XVM8

Literature

PMID: 22846038

PMID: 22253868

Note

Manual Curation

December 12, 2017

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

F-box-like domain superfamily (IPR036047)

Leucine-rich repeat domain superfamily (IPR032675)

F-box domain (IPR001810)

Leucine-rich repeat, cysteine-containing subtype (IPR006553)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

J023123O09 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0395600-02)

RiceXPro (AK100862)

Others

Oryzabase (9793)

Transcript

2145 bp

>Os04t0395600-02 Auxin receptor, Flag leaf inclination, Primary root growth, Crown root initiation, Seed development, Tillering
GCCCCCCTGTTGCTTCGCTTCCTTCCAGATCTGAAACCCATGTGAATGCTGCTCCTGCTG
CTACTTTGAGATAGAGCATTGCGTGTTCTTGGATTGGTGGATGATGAGGTGAAAGTGAAG
AGGGGGAGAGTGTGTTTCCTGTTTGTGAGAGATTTTTTTCTCTGAATAAACCTGGAGCCG
TGGAGGAGGAAGCAGATCCTATCGTGTAGCTCCCGCGGCGGCGGCTGCGGTGGTGGTGGG
GAAGAGGAAGAAGAAGGCGGTGGCGGCGGCGGAGCCATGACGTACTTCCCGGAGGAGGTG
GTGGAGCACATCTTCAGCTTCCTGCCGGCGCAGCGCGACCGCAACACGGTCTCGCTCGTC
TGCAAGGTGTGGTACGAGATCGAGAGGCTGAGCCGCCGCGGCGTCTTCGTGGGCAACTGC
TACGCCGTGCGCGCCGGCCGCGTCGCCGCGCGGTTCCCCAACGTGCGGGCGCTCACGGTG
AAGGGGAAGCCCCACTTCGCCGACTTCAACCTCGTGCCCCCCGACTGGGGCGGCTACGCG
GGGCCGTGGATCGAGGCGGCCGCGAGGGGATGCCACGGCCTGGAGGAGCTCAGGATGAAG
CGGATGGTGGTGTCCGACGAGAGCCTCGAGCTGCTGGCTCGCTCGTTCCCGCGGTTCAGG
GCTCTTGTTCTTATCAGCTGCGAGGGGTTCAGCACTGACGGGCTAGCCGCCGTCGCGAGC
CATTGCAAGCTTCTGAGGGAGTTGGATTTGCAGGAAAATGAAGTGGAGGATCGAGGGCCT
AGGTGGCTTTCCTGCTTCCCTGATTCCTGCACATCACTTGTCTCATTGAATTTTGCCTGC
ATCAAAGGGGAGGTTAATGCTGGTTCACTGGAGAGACTTGTTAGCAGGTCCCCAAACCTG
CGGAGTTTGAGGCTGAATCGATCTGTATCGGTAGATACACTTGCAAAGATACTACTGCGT
ACCCCTAACTTGGAGGATTTGGGGACAGGGAATTTGACAGATGACTTCCAAACTGAGTCC
TACTTTAAGCTTACCAGTGCTCTGGAGAAATGCAAGATGTTGAGGAGTTTGTCTGGATTC
TGGGATGCTTCTCCTGTTTGCCTGTCATTTATCTACCCCCTGTGTGCTCAACTGACAGGA
TTGAACTTGAGCTATGCCCCCACACTTGATGCTTCTGACCTTACAAAAATGATTAGCCGC
TGTGTGAAGCTCCAACGCCTTTGGGTACTGGATTGTATCTCGGACAAAGGCTTGCAAGTG
GTGGCCTCCAGTTGCAAAGACTTGCAAGAACTCAGGGTATTTCCATCAGATTTCTACGTA
GCTGGTTATTCTGCAGTGACAGAGGAGGGACTTGTTGCAGTATCCTTGGGCTGTCCAAAA
CTGAACTCACTACTGTACTTCTGTCACCAAATGACTAATGCTGCACTAGTTACTGTCGCC
AAGAACTGTCCAAATTTCACACGATTCAGACTTTGTATTCTTGAGCCAGGGAAGCCTGAT
GTTGTGACAAGCCAACCATTAGATGAAGGCTTTGGAGCTATTGTTCGTGAGTGCAAGGGA
TTACAACGTTTGTCAATATCTGGTCTTCTCACAGACAAAGTTTTCATGTATATTGGGAAA
TATGCAAAACAACTTGAGATGCTTTCTATAGCATTTGCTGGTGACAGTGATAAGGGTATG
ATGCATGTTATGAATGGATGCAAGAATTTAAGGAAACTGGAGATAAGAGATAGCCCGTTT
GGTGATGCTGCACTCTTGGGGAATTTTGCTAGGTACGAGACAATGCGATCCCTTTGGATG
TCATCTTGCAATGTCACGTTAAAGGGGTGCCAAGTCCTTGCGTCAAAGATGCCGATGCTC
AATGTTGAGGTCATAAATGAGCGGGATGGTAGCAATGAAATGGAGGAAAACCATGGAGAT
CTGCCTAAAGTGGAGAAATTATATGTGTACCGCACAACTGCTGGGGCGAGGGATGATGCA
CCAAATTTTGTTAAAATCCTATAGAGCTAGCTGAGAGTAGCAAGGAATCCTCTTATTCCA
TAAGGTAACCCCTTTCAATACATTATTTTCAAAGTGCCTTTCTATAGTTAATGAGTTTGC
CTGTTACTCTGTTAGCCTATTAATACTAGTGCTGTTTGAACTTGC

CDS

1728 bp

>Os04t0395600-02 Auxin receptor, Flag leaf inclination, Primary root growth, Crown root initiation, Seed development, Tillering
ATGACGTACTTCCCGGAGGAGGTGGTGGAGCACATCTTCAGCTTCCTGCCGGCGCAGCGC
GACCGCAACACGGTCTCGCTCGTCTGCAAGGTGTGGTACGAGATCGAGAGGCTGAGCCGC
CGCGGCGTCTTCGTGGGCAACTGCTACGCCGTGCGCGCCGGCCGCGTCGCCGCGCGGTTC
CCCAACGTGCGGGCGCTCACGGTGAAGGGGAAGCCCCACTTCGCCGACTTCAACCTCGTG
CCCCCCGACTGGGGCGGCTACGCGGGGCCGTGGATCGAGGCGGCCGCGAGGGGATGCCAC
GGCCTGGAGGAGCTCAGGATGAAGCGGATGGTGGTGTCCGACGAGAGCCTCGAGCTGCTG
GCTCGCTCGTTCCCGCGGTTCAGGGCTCTTGTTCTTATCAGCTGCGAGGGGTTCAGCACT
GACGGGCTAGCCGCCGTCGCGAGCCATTGCAAGCTTCTGAGGGAGTTGGATTTGCAGGAA
AATGAAGTGGAGGATCGAGGGCCTAGGTGGCTTTCCTGCTTCCCTGATTCCTGCACATCA
CTTGTCTCATTGAATTTTGCCTGCATCAAAGGGGAGGTTAATGCTGGTTCACTGGAGAGA
CTTGTTAGCAGGTCCCCAAACCTGCGGAGTTTGAGGCTGAATCGATCTGTATCGGTAGAT
ACACTTGCAAAGATACTACTGCGTACCCCTAACTTGGAGGATTTGGGGACAGGGAATTTG
ACAGATGACTTCCAAACTGAGTCCTACTTTAAGCTTACCAGTGCTCTGGAGAAATGCAAG
ATGTTGAGGAGTTTGTCTGGATTCTGGGATGCTTCTCCTGTTTGCCTGTCATTTATCTAC
CCCCTGTGTGCTCAACTGACAGGATTGAACTTGAGCTATGCCCCCACACTTGATGCTTCT
GACCTTACAAAAATGATTAGCCGCTGTGTGAAGCTCCAACGCCTTTGGGTACTGGATTGT
ATCTCGGACAAAGGCTTGCAAGTGGTGGCCTCCAGTTGCAAAGACTTGCAAGAACTCAGG
GTATTTCCATCAGATTTCTACGTAGCTGGTTATTCTGCAGTGACAGAGGAGGGACTTGTT
GCAGTATCCTTGGGCTGTCCAAAACTGAACTCACTACTGTACTTCTGTCACCAAATGACT
AATGCTGCACTAGTTACTGTCGCCAAGAACTGTCCAAATTTCACACGATTCAGACTTTGT
ATTCTTGAGCCAGGGAAGCCTGATGTTGTGACAAGCCAACCATTAGATGAAGGCTTTGGA
GCTATTGTTCGTGAGTGCAAGGGATTACAACGTTTGTCAATATCTGGTCTTCTCACAGAC
AAAGTTTTCATGTATATTGGGAAATATGCAAAACAACTTGAGATGCTTTCTATAGCATTT
GCTGGTGACAGTGATAAGGGTATGATGCATGTTATGAATGGATGCAAGAATTTAAGGAAA
CTGGAGATAAGAGATAGCCCGTTTGGTGATGCTGCACTCTTGGGGAATTTTGCTAGGTAC
GAGACAATGCGATCCCTTTGGATGTCATCTTGCAATGTCACGTTAAAGGGGTGCCAAGTC
CTTGCGTCAAAGATGCCGATGCTCAATGTTGAGGTCATAAATGAGCGGGATGGTAGCAAT
GAAATGGAGGAAAACCATGGAGATCTGCCTAAAGTGGAGAAATTATATGTGTACCGCACA
ACTGCTGGGGCGAGGGATGATGCACCAAATTTTGTTAAAATCCTATAG

Protein

576 aa

>Os04t0395600-02 Auxin receptor, Flag leaf inclination, Primary root growth, Crown root initiation, Seed development, Tillering
MTYFPEEVVEHIFSFLPAQRDRNTVSLVCKVWYEIERLSRRGVFVGNCYAVRAGRVAARF
PNVRALTVKGKPHFADFNLVPPDWGGYAGPWIEAAARGCHGLEELRMKRMVVSDESLELL
ARSFPRFRALVLISCEGFSTDGLAAVASHCKLLRELDLQENEVEDRGPRWLSCFPDSCTS
LVSLNFACIKGEVNAGSLERLVSRSPNLRSLRLNRSVSVDTLAKILLRTPNLEDLGTGNL
TDDFQTESYFKLTSALEKCKMLRSLSGFWDASPVCLSFIYPLCAQLTGLNLSYAPTLDAS
DLTKMISRCVKLQRLWVLDCISDKGLQVVASSCKDLQELRVFPSDFYVAGYSAVTEEGLV
AVSLGCPKLNSLLYFCHQMTNAALVTVAKNCPNFTRFRLCILEPGKPDVVTSQPLDEGFG
AIVRECKGLQRLSISGLLTDKVFMYIGKYAKQLEMLSIAFAGDSDKGMMHVMNGCKNLRK
LEIRDSPFGDAALLGNFARYETMRSLWMSSCNVTLKGCQVLASKMPMLNVEVINERDGSN
EMEENHGDLPKVEKLYVYRTTAGARDDAPNFVKIL*

5'UTR

chr04:19457365..19457640 (- strand) : 276 bp

CDS

chr04:19456913..19457364 (- strand) : 452 bp

chr04:19455807..19456302 (- strand) : 496 bp

chr04:19454926..19455705 (- strand) : 780 bp

3'UTR

chr04:19454785..19454925 (- strand) : 141 bp

FASTA

>Os04t0395600-02 class=Sequence position=chr04:19454785..19457640 (- strand)
GCCCCCCTGT TGCTTCGCTT CCTTCCAGAT CTGAAACCCA TGTGAATGCT GCTCCTGCTG CTACTTTGAG ATAGAGCATT
GCGTGTTCTT GGATTGGTGG ATGATGAGGT GAAAGTGAAG AGGGGGAGAG TGTGTTTCCT GTTTGTGAGA GATTTTTTTC
TCTGAATAAA CCTGGAGCCG TGGAGGAGGA AGCAGATCCT ATCGTGTAGC TCCCGCGGCG GCGGCTGCGG TGGTGGTGGG
GAAGAGGAAG AAGAAGGCGG TGGCGGCGGC GGAGCCATGA CGTACTTCCC GGAGGAGGTG GTGGAGCACA TCTTCAGCTT
CCTGCCGGCG CAGCGCGACC GCAACACGGT CTCGCTCGTC TGCAAGGTGT GGTACGAGAT CGAGAGGCTG AGCCGCCGCG
GCGTCTTCGT GGGCAACTGC TACGCCGTGC GCGCCGGCCG CGTCGCCGCG CGGTTCCCCA ACGTGCGGGC GCTCACGGTG
AAGGGGAAGC CCCACTTCGC CGACTTCAAC CTCGTGCCCC CCGACTGGGG CGGCTACGCG GGGCCGTGGA TCGAGGCGGC
CGCGAGGGGA TGCCACGGCC TGGAGGAGCT CAGGATGAAG CGGATGGTGG TGTCCGACGA GAGCCTCGAG CTGCTGGCTC
GCTCGTTCCC GCGGTTCAGG GCTCTTGTTC TTATCAGCTG CGAGGGGTTC AGCACTGACG GGCTAGCCGC CGTCGCGAGC
CATTGCAAGT GAGTGCTTCA GATTCTTTTA TGTTTCAATC GCTGCTGTGA GCTTGTGATA TTCTTCTCTG CTTTGGCAAT
GTAGTTTGTA GTTGCATACT CTCTGCAGTT TAGAGTTGAA TGGATCGATT TTGATCTGTT GAATTTCATA CATCTTTTAG
CTACAGGTTC TTGCTAATCA TAGAACATAG GGGGTTAGGG GGGACCTTTG CAGTGTTTGA AGGAACAAGA TGCATCTGGC
ATTTCTATAT TCTGTTCGAA CTTTGTTTTA CATCGAGGCA TTCATCTTCT GTGATGTTTC ATTGTGTTCT TTTTTACTTG
TACAGAGCAA TTCTAAATTG AAGTGCATGT GATTATTACC ACTTCCATTA TTGGCTTTCT TCTGTGATTG TTGTTTACTA
GATGAATTGG TATTCTTGTG GCCGTTGTTC TATATTGAAC CAACTGGCAT GAGCTTTATT GTTGTGGCCA TTTTCTTTAG
ACTACTTGCT AGGGATGGAT GCAAATTCTG TTTAGGTTAC TGAATAACTT ACTGTTGCTT TGGTTTTAAT TTGTTATGGT
TACACTCATT TTTATGGCTT ATATGCTGAC ACTGTTTTCT TCTCTTTCTG TTGCCTAGGC TTCTGAGGGA GTTGGATTTG
CAGGAAAATG AAGTGGAGGA TCGAGGGCCT AGGTGGCTTT CCTGCTTCCC TGATTCCTGC ACATCACTTG TCTCATTGAA
TTTTGCCTGC ATCAAAGGGG AGGTTAATGC TGGTTCACTG GAGAGACTTG TTAGCAGGTC CCCAAACCTG CGGAGTTTGA
GGCTGAATCG ATCTGTATCG GTAGATACAC TTGCAAAGAT ACTACTGCGT ACCCCTAACT TGGAGGATTT GGGGACAGGG
AATTTGACAG ATGACTTCCA AACTGAGTCC TACTTTAAGC TTACCAGTGC TCTGGAGAAA TGCAAGATGT TGAGGAGTTT
GTCTGGATTC TGGGATGCTT CTCCTGTTTG CCTGTCATTT ATCTACCCCC TGTGTGCTCA ACTGACAGGA TTGAACTTGA
GCTATGCCCC CACACTTGAT GCTTCTGACC TTACAAAAAT GATTAGCCGC TGTGTGAAGC TCCAACGCCT TTGGGTGAGT
TCCCTTGTTG GTTTGTACTT ATTCTTGTTT GTTGTTGTTG TTGTTGCCCT TTGGTAATAT CAAGCAAGTA ACGGTATTGA
GCCTTTATAT TGCAGGTACT GGATTGTATC TCGGACAAAG GCTTGCAAGT GGTGGCCTCC AGTTGCAAAG ACTTGCAAGA
ACTCAGGGTA TTTCCATCAG ATTTCTACGT AGCTGGTTAT TCTGCAGTGA CAGAGGAGGG ACTTGTTGCA GTATCCTTGG
GCTGTCCAAA ACTGAACTCA CTACTGTACT TCTGTCACCA AATGACTAAT GCTGCACTAG TTACTGTCGC CAAGAACTGT
CCAAATTTCA CACGATTCAG ACTTTGTATT CTTGAGCCAG GGAAGCCTGA TGTTGTGACA AGCCAACCAT TAGATGAAGG
CTTTGGAGCT ATTGTTCGTG AGTGCAAGGG ATTACAACGT TTGTCAATAT CTGGTCTTCT CACAGACAAA GTTTTCATGT
ATATTGGGAA ATATGCAAAA CAACTTGAGA TGCTTTCTAT AGCATTTGCT GGTGACAGTG ATAAGGGTAT GATGCATGTT
ATGAATGGAT GCAAGAATTT AAGGAAACTG GAGATAAGAG ATAGCCCGTT TGGTGATGCT GCACTCTTGG GGAATTTTGC
TAGGTACGAG ACAATGCGAT CCCTTTGGAT GTCATCTTGC AATGTCACGT TAAAGGGGTG CCAAGTCCTT GCGTCAAAGA
TGCCGATGCT CAATGTTGAG GTCATAAATG AGCGGGATGG TAGCAATGAA ATGGAGGAAA ACCATGGAGA TCTGCCTAAA
GTGGAGAAAT TATATGTGTA CCGCACAACT GCTGGGGCGA GGGATGATGC ACCAAATTTT GTTAAAATCC TATAGAGCTA
GCTGAGAGTA GCAAGGAATC CTCTTATTCC ATAAGGTAAC CCCTTTCAAT ACATTATTTT CAAAGTGCCT TTCTATAGTT
AATGAGTTTG CCTGTTACTC TGTTAGCCTA TTAATACTAG TGCTGTTTGA ACTTGC

Locus: Os04g0395600

Loading...

Locus: Os04g0395600

Loading...