Os04t0395600-03

Locus

Os04g0395600

Description

Similar to AFB2 (AUXIN SIGNALING F-BOX 2); auxin binding / ubiquitin-protein ligase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsAFB2, ABF2, OsAFB2-1, OsAFB2-2, OsFbox206, Os_F0492

Oryzabase Gene Name Synonym(s)

Auxin signaling f-box 2, Auxin F-box protein 2, F-box protein 206

Transcript Evidence

AK103960 (DDBJ, Best hit)

Protein Evidence

NP_566800.1 (RefSeq)

Literature

Note

Manual Curation

Full-length cDNA

001-015-D07 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0395600-03)

RiceXPro (AK103960)

Others

Oryzabase (9793)

KEGG (Os04t0395600-03)

Transcript

739 bp

>Os04t0395600-03 Similar to AFB2 (AUXIN SIGNALING F-BOX 2); auxin binding / ubiquitin-protein ligase.
AGACAATGCGATCCCTTTGGATGTCATCTTGCAATGTCACGTTAAAGGGGTGCCAAGTCC
TTGCGTCAAAGATGCCGATGCTCAATGTTGAGGTCATAAATGAGCGGGATGGTAGCAATG
AAATGGAGGAAAACCATGGAGATCTGCCTAAAGTGGAGAAATTATATGTGTACCGCACAA
CTGCTGGGGCGAGGGATGATGCACCAAATTTTGTTAAAATCCTATAGAGCTAGCTGAGAG
TAGCAAGGAATCCTCTTATTCCATAAGATGGTCGGCGGAATCTGGGAGGAGGCCGGGGCC
GCGGCAACAGTGGTAAGCTCTTCAAGTGTCTCCTCCTCTCCTTTGCAGGGACAGGAAAAA
CCACGTTGGTGTGCCTCCCTTATCTCGGAGCATCTGGCCTGGGATCATCATCCATCATCC
CCCCGTTTCGCCTTTTAGCCCGTTTGGTCATACCGACGAGGCCCTTATCCTGTTGTGCAA
TTCTGAGCAAGCTCAGGACCACCACCAATCCATCATGTTAGCTCGACCTTTTCTCTCTTC
TTCCCTTTATTATTTTTTCTTCTTTTTTTACCTTGTGTAATATGTAGAACCCACTTCCAT
TTGCTTTTGACATTTGCCACAGCGGATTGTGCTGCTGCTGGTTGTAATGCTTGTTTTCAA
GCCTCCTGACCGGGACGTTTCGGGGACGATGATTAGTTTCCTTCTCTTTGCTCCTGTGAA
TGCAGTCAGTGCCTGGAAT

CDS

225 bp

>Os04t0395600-03 Similar to AFB2 (AUXIN SIGNALING F-BOX 2); auxin binding / ubiquitin-protein ligase.
ACAATGCGATCCCTTTGGATGTCATCTTGCAATGTCACGTTAAAGGGGTGCCAAGTCCTT
GCGTCAAAGATGCCGATGCTCAATGTTGAGGTCATAAATGAGCGGGATGGTAGCAATGAA
ATGGAGGAAAACCATGGAGATCTGCCTAAAGTGGAGAAATTATATGTGTACCGCACAACT
GCTGGGGCGAGGGATGATGCACCAAATTTTGTTAAAATCCTATAG

Protein

75 aa

>Os04t0395600-03 Similar to AFB2 (AUXIN SIGNALING F-BOX 2); auxin binding / ubiquitin-protein ligase.
TMRSLWMSSCNVTLKGCQVLASKMPMLNVEVINERDGSNEMEENHGDLPKVEKLYVYRTT
AGARDDAPNFVKIL*

5'UTR

chr04:19455151..19455152 (- strand) : 2 bp

CDS

chr04:19454926..19455150 (- strand) : 225 bp

3'UTR

chr04:19454886..19454925 (- strand) : 40 bp

chr04:19453786..19454257 (- strand) : 472 bp

FASTA

>Os04t0395600-03 class=Sequence position=chr04:19453786..19455152 (- strand)
AGACAATGCG ATCCCTTTGG ATGTCATCTT GCAATGTCAC GTTAAAGGGG TGCCAAGTCC TTGCGTCAAA GATGCCGATG
CTCAATGTTG AGGTCATAAA TGAGCGGGAT GGTAGCAATG AAATGGAGGA AAACCATGGA GATCTGCCTA AAGTGGAGAA
ATTATATGTG TACCGCACAA CTGCTGGGGC GAGGGATGAT GCACCAAATT TTGTTAAAAT CCTATAGAGC TAGCTGAGAG
TAGCAAGGAA TCCTCTTATT CCATAAGGTA ACCCCTTTCA ATACATTATT TTCAAAGTGC CTTTCTATAG TTAATGAGTT
TGCCTGTTAC TCTGTTAGCC TATTAATACT AGTGCTGTTT GAACTTGCAT CGTTTTTTTT TTGTACCTTG GCTCGTTTTG
GTCACTAGAT CCTTTTATTC TCATTGCATG CCCCATTGCC TCTCAACATG AAAACTAGGA GTATCTGGTG GCTCTTGTAG
CTCACTCTGT TCAGATATAA TTTGCTTAGC TCAGGACTGA CTTTGAACGA TTCATGTCAG CCTGCATTTT TTTTTCCAAG
ATAAAATTAA CAGTTTATCC TTAAACTTCT ATACAAAATC AATTCTGCAT GAGGAAGCTT CTGCTATGAT AAAATCCAAA
GTGTAAATTA AGGCTGATTC CTGAAAAGAT TGAACTGGGT ATAATAGTAC TTGCAACATG ATGCTTTGAG CAAACCTTTA
TTCTGCGTCA ATCTTTATCC ACTCTTTTTG TTTTCTTTCC GCCCCCGGTA CAGATCGTAG CTACTCATAG CTCTAAAATT
CCCCTCAACG CGATTGTTAC CGTTCAGTTT GGGATAGGGG GCTTTGCCAG ATGAGCATGA GCCCCCATCT AACCCCCACT
CGATTGCTCT TGCAGATGGT CGGCGGAATC TGGGAGGAGG CCGGGGCCGC GGCAACAGTG GTAAGCTCTT CAAGTGTCTC
CTCCTCTCCT TTGCAGGGAC AGGAAAAACC ACGTTGGTGT GCCTCCCTTA TCTCGGAGCA TCTGGCCTGG GATCATCATC
CATCATCCCC CCGTTTCGCC TTTTAGCCCG TTTGGTCATA CCGACGAGGC CCTTATCCTG TTGTGCAATT CTGAGCAAGC
TCAGGACCAC CACCAATCCA TCATGTTAGC TCGACCTTTT CTCTCTTCTT CCCTTTATTA TTTTTTCTTC TTTTTTTACC
TTGTGTAATA TGTAGAACCC ACTTCCATTT GCTTTTGACA TTTGCCACAG CGGATTGTGC TGCTGCTGGT TGTAATGCTT
GTTTTCAAGC CTCCTGACCG GGACGTTTCG GGGACGATGA TTAGTTTCCT TCTCTTTGCT CCTGTGAATG CAGTCAGTGC
CTGGAAT

Locus: Os04g0395600

Loading...

Locus: Os04g0395600

Loading...