Os04t0401000-01

Locus

Os04g0401000

Description

Proline-rich protein, Blast resistance

RAP-DB Gene Symbol Synonym(s)

PI21, pi21, rMg40

RAP-DB Gene Name Synonym(s)

PYRICULARIA ORYZAE RESISTANCE 21, Pyricularia oryzae resistance-21 (field resistance), Pyricularia oryzae resistance-21, Magnaporthe grisea resistance-21 (field resistance), Magnaporthe grisea resistance-21.

CGSNL Gene Symbol

PI21

CGSNL Gene Name

PYRICULARIA ORYZAE RESISTANCE 21

Oryzabase Gene Symbol Synonym(s)

pi21, rMg40, OsHMP26, HMP26

Oryzabase Gene Name Synonym(s)

Pyricularia oryzae resistance-21 (field resistance), Pyricularia oryzae resistance-21, Magnaporthe grisea resistance-21 (field resistance), Magnaporthe grisea resistance-21, Heavy metal-associated protein 26

Transcript Evidence

AB430852 (susceptible allele) (DDBJ)

AK072320 (susceptible allele) (DDBJ)

AK070581 (susceptible allele) (DDBJ)

AB430853 (resistant allele) (DDBJ)

Protein Evidence

Q7XL73 (susceptible allele) (UniProt)

B5UA05 (resistant allele) (UniProt)

Literature

PMID: 19696351

Note

Manual Curation

May 27, 2010

Full-length cDNA

J023029D20 (Online Clone Ordering)

J023062P06 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0401000-01)

Others

Oryzabase (2057)

Transcript

1183 bp

>Os04t0401000-01 Proline-rich protein, Blast resistance
CCATCCATGCATCGCCTCCATTATTCATGCTTCGATTCTCCATGCTTTCCTCTACTGCTC
ATTGGTAACATTCGGCAAATTTGACAGATGGGTATATTGGTCATCTTGGTGGACCTGCAA
TGCTGCCGCTGCGATGCCAAGATCAGGAAGGTCCTGGGCTGCCTTGAAGAGGAGTACTGC
ATCGAGAAGGTGGAGTACGACGTGAAGAACAACAGGGTGATCGTGCGCGGGAAGTTCGAC
CCGGAGAAGCTGTGCAAGAAGATCTGGTGCAAGGCCGGCAAGATCATCAAGGAGATCCTC
ATCGTCGACGTCTGGCCGCCGCCGCTGCCGCAGCCGCCGCCGCCGTGCAAGCCGCCGCCG
TGCGAGAAGCCTCCGGAGGACTGCAAGCCCAAGCCCTGCCATTGCTGCAGCTGCGAGAAG
CCCAAGCCCAAGCCCAAGCCCTGCCACTGCGAGAAGCCCAAGCCCTGTCACTGCGAGAAG
CCCAAGCCATGCGAGAAGCCGCCGCCGTGCAAGCCGGAGGAGCCGCCGAAGCCGCCGCCG
GAGAAGCCGCCGCCGAAGCCGGAGTGCAAGCTGGTGCCGTACCCTTACCCGGTGCCGTAC
CCGTACGCCGGGCAGTGGTGCTGCCCAAAGCCTGAGCCGCCGAAGCCGCCGCCGGAGCCA
CCGAAGGAGCCGGAGCCGCCGAAGCCGTGCGGGTGCTCGCACGCCTTCGTGTGCGTCTGC
AAGCCGGCGCCGCCGCCGCCGCCGCCGTGCGGGTGCTCGGGGGGCCACGGGAACTGCGGC
TGCGGCATCAGGCCGTGGCCGCCGCAGGTGTGGCCGCCGCCGCCCGTCTGCCCGCCGCCG
CCGTGGTGCTACACCGAGGACAACGCCAACGCCTGCTCCATCATGTGATGGCCGGCCGGC
GGTCGGCGTCGATCACGATCATCTCTGCTGCTTAATTTCCTTGCTTGCTACTACCTCTGC
TCCTTTCCTTGCCTCGGAAATCGGAATAAATTAAACACGAGGCTGATCGATGTGTTTGTA
ATTAATCCATGGTGTTTGTGTTGTGTGCTGTGTGGGCTGTATAATAATTAATTACAGTAT
GTTCATGTAAATTTGTTTGTTTGTTTGTTTATGTTGTTCGATATGTATAATTATGTACAA
TAATTAATCGTGGAGAGGCTCACTAAACTCATAAACTGTAGAG

CDS

801 bp

>Os04t0401000-01 Proline-rich protein, Blast resistance
ATGGGTATATTGGTCATCTTGGTGGACCTGCAATGCTGCCGCTGCGATGCCAAGATCAGG
AAGGTCCTGGGCTGCCTTGAAGAGGAGTACTGCATCGAGAAGGTGGAGTACGACGTGAAG
AACAACAGGGTGATCGTGCGCGGGAAGTTCGACCCGGAGAAGCTGTGCAAGAAGATCTGG
TGCAAGGCCGGCAAGATCATCAAGGAGATCCTCATCGTCGACGTCTGGCCGCCGCCGCTG
CCGCAGCCGCCGCCGCCGTGCAAGCCGCCGCCGTGCGAGAAGCCTCCGGAGGACTGCAAG
CCCAAGCCCTGCCATTGCTGCAGCTGCGAGAAGCCCAAGCCCAAGCCCAAGCCCTGCCAC
TGCGAGAAGCCCAAGCCCTGTCACTGCGAGAAGCCCAAGCCATGCGAGAAGCCGCCGCCG
TGCAAGCCGGAGGAGCCGCCGAAGCCGCCGCCGGAGAAGCCGCCGCCGAAGCCGGAGTGC
AAGCTGGTGCCGTACCCTTACCCGGTGCCGTACCCGTACGCCGGGCAGTGGTGCTGCCCA
AAGCCTGAGCCGCCGAAGCCGCCGCCGGAGCCACCGAAGGAGCCGGAGCCGCCGAAGCCG
TGCGGGTGCTCGCACGCCTTCGTGTGCGTCTGCAAGCCGGCGCCGCCGCCGCCGCCGCCG
TGCGGGTGCTCGGGGGGCCACGGGAACTGCGGCTGCGGCATCAGGCCGTGGCCGCCGCAG
GTGTGGCCGCCGCCGCCCGTCTGCCCGCCGCCGCCGTGGTGCTACACCGAGGACAACGCC
AACGCCTGCTCCATCATGTGA

Protein

267 aa

>Os04t0401000-01 Proline-rich protein, Blast resistance
MGILVILVDLQCCRCDAKIRKVLGCLEEEYCIEKVEYDVKNNRVIVRGKFDPEKLCKKIW
CKAGKIIKEILIVDVWPPPLPQPPPPCKPPPCEKPPEDCKPKPCHCCSCEKPKPKPKPCH
CEKPKPCHCEKPKPCEKPPPCKPEEPPKPPPEKPPPKPECKLVPYPYPVPYPYAGQWCCP
KPEPPKPPPEPPKEPEPPKPCGCSHAFVCVCKPAPPPPPPCGCSGGHGNCGCGIRPWPPQ
VWPPPPVCPPPPWCYTEDNANACSIM*

5'UTR

chr04:19836806..19836892 (- strand) : 87 bp

CDS

chr04:19836356..19836437 (- strand) : 82 bp

chr04:19835501..19836219 (- strand) : 719 bp

3'UTR

chr04:19835206..19835500 (- strand) : 295 bp

FASTA

>Os04t0401000-01 class=Sequence position=chr04:19835206..19836892 (- strand)
CCATCCATGC ATCGCCTCCA TTATTCATGC TTCGATTCTC CATGCTTTCC TCTACTGCTC ATTGGTAACA TTCGGCAAAT
TTGACAGGTG AGCTCAGTAT TTTAAATCTT AATGTAGTAC TTTGGTGTGC TAATCTTTGC TCTGTTCAAA AGAGAATTCT
GGTTTCTTTG CTATTTTGAA AAGAGAATTT TCGTTACAGG ACTTCAACTT CCATAATACT TTTTTTTATA ATTAAGGCAT
GATATATATC TTCTTTCTGA ATTCCACGGG AATTGCACTT TTTCCTGAGA AATTTGTAAA GAGCATGCCT GTTAATTGCA
AGGGGCCCCT AACTCTGTTA TGAGAAAAGA GAACTATATA AGATGCTCAA TAAGCACCTC TTTTTTTTTT TCTGTTAACT
GACCAAAGCC TGTCTATCTG CATTTTTTTT TGTTTTTTGT TTTTCTTGTG TGCAGATGGG TATATTGGTC ATCTTGGTGG
ACCTGCAATG CTGCCGCTGC GATGCCAAGA TCAGGAAGGT CCTGGGCTGC CTTGAAGGTA TAATAAATTC TGCCCGAATC
GTCCATGTTT GATTGAATTT TCAAGGCTAA TCAGCAGTGT TCCTGCTCAA TTGGGAGCAA AACCTCTGTT AAAAAGGGTG
TGTTTGAATG AATATAATTG AATATGAACG CAGAGGAGTA CTGCATCGAG AAGGTGGAGT ACGACGTGAA GAACAACAGG
GTGATCGTGC GCGGGAAGTT CGACCCGGAG AAGCTGTGCA AGAAGATCTG GTGCAAGGCC GGCAAGATCA TCAAGGAGAT
CCTCATCGTC GACGTCTGGC CGCCGCCGCT GCCGCAGCCG CCGCCGCCGT GCAAGCCGCC GCCGTGCGAG AAGCCTCCGG
AGGACTGCAA GCCCAAGCCC TGCCATTGCT GCAGCTGCGA GAAGCCCAAG CCCAAGCCCA AGCCCTGCCA CTGCGAGAAG
CCCAAGCCCT GTCACTGCGA GAAGCCCAAG CCATGCGAGA AGCCGCCGCC GTGCAAGCCG GAGGAGCCGC CGAAGCCGCC
GCCGGAGAAG CCGCCGCCGA AGCCGGAGTG CAAGCTGGTG CCGTACCCTT ACCCGGTGCC GTACCCGTAC GCCGGGCAGT
GGTGCTGCCC AAAGCCTGAG CCGCCGAAGC CGCCGCCGGA GCCACCGAAG GAGCCGGAGC CGCCGAAGCC GTGCGGGTGC
TCGCACGCCT TCGTGTGCGT CTGCAAGCCG GCGCCGCCGC CGCCGCCGCC GTGCGGGTGC TCGGGGGGCC ACGGGAACTG
CGGCTGCGGC ATCAGGCCGT GGCCGCCGCA GGTGTGGCCG CCGCCGCCCG TCTGCCCGCC GCCGCCGTGG TGCTACACCG
AGGACAACGC CAACGCCTGC TCCATCATGT GATGGCCGGC CGGCGGTCGG CGTCGATCAC GATCATCTCT GCTGCTTAAT
TTCCTTGCTT GCTACTACCT CTGCTCCTTT CCTTGCCTCG GAAATCGGAA TAAATTAAAC ACGAGGCTGA TCGATGTGTT
TGTAATTAAT CCATGGTGTT TGTGTTGTGT GCTGTGTGGG CTGTATAATA ATTAATTACA GTATGTTCAT GTAAATTTGT
TTGTTTGTTT GTTTATGTTG TTCGATATGT ATAATTATGT ACAATAATTA ATCGTGGAGA GGCTCACTAA ACTCATAAAC
TGTAGAG