Os04t0401000-02

Locus

Os04g0401000

Description

Similar to Pi21 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PI21

CGSNL Gene Name

PYRICULARIA ORYZAE RESISTANCE 21

Oryzabase Gene Symbol Synonym(s)

pi21, rMg40

Oryzabase Gene Name Synonym(s)

Pyricularia oryzae resistance-21 (field resistance), Pyricularia oryzae resistance-21, Magnaporthe grisea resistance-21 (field resistance), Magnaporthe grisea resistance-21.

Transcript Evidence

AK106153 (DDBJ, Best hit)

Protein Evidence

B5UA05 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-208-A01 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0401000-02)

RiceXPro (AK106153)

Others

Oryzabase (2057)

KEGG (Os04t0401000-02)

Transcript

1007 bp

>Os04t0401000-02 Similar to Pi21 protein.
ATGCATCGCCTCCATTATTCATGCTTCGATTCTCCATGCTTTCCTCTACTGCTCATTGGT
AACATTCGGCAAATTTGACAGATGGGTATATTGGTCATCTTGGTGGACCTGCAATGCTGC
CGCTGCGATGCCAAGATCAGGAAGGTCCTGGGCTGCCTTGAAGAGGAGTACTGCATCGAG
AAGGTGGAGTACGACGTGAAGAACAACAGGGTGATCGTGCGCGGGAAGTTCGACCCGGAG
AAGCTGTGCAAGAAGATCTGGTGCAAGGCCGGCAAGATCATCAAGGAGATCCTCATCGTC
GACGTCTGGCCGCCGCCGCTGCCGCAGCCGCCGCCGCCGTGCAAGCCGCCGCCGTGCGAG
AAGCCTCCGGAGGACTGCAAGCCCAAGCCCTGCCATTGCTGCAGCTGCGAGAAGCCCAAG
CCCAAGCCCAAGCCCTGCCACTGCGAGAAGCCCAAGCCCTGTCACTGCGAGAAGCCCAAG
CCATGCGAGAAGCCGCCGCCGTGCAAGCCGGAGGAGCCGCCGAAGCCGCCGCCGGAGAAG
CCGCCGCCGAAGCCGGAGTGCAAGCTGGTGCCGTACCCTTACCCGGTGCCGTACCCGTAC
GCCGGGCAGTGGTGCTGCCCAAAGCCTGAGCCGCCGAAGCCGCCGCCGCCCGTCTGCCCG
CCGCCGCCGTGGTGCTACACCGAGGACAACGCCAACGCCTGCTCCATCATGTGATGGCCG
GCCGGCGGTCGGCGTCGATCACGATCATCTCTGCTGCTTAATTTCCTTGCTTGCTACTAC
CTCTGCTCCTTTCCTTGCCTCGGAAATCGGAATAAATTAAACACGAGGCTGATCGATGTG
TTTGTAATTAATCCATGGTGTTTGTGTTGTGTGCTGTGTGGGCTGTATAATAATTAATTA
CAGTATGTTCATGTAAATTTGTTTGTTTGTTTGTTTATGTTGTTCGATATGTATAATTAT
GTACAATAATTAATCGTGGAGAGGCTCACTAAACTCATAAACTGTAG

CDS

633 bp

>Os04t0401000-02 Similar to Pi21 protein.
ATGGGTATATTGGTCATCTTGGTGGACCTGCAATGCTGCCGCTGCGATGCCAAGATCAGG
AAGGTCCTGGGCTGCCTTGAAGAGGAGTACTGCATCGAGAAGGTGGAGTACGACGTGAAG
AACAACAGGGTGATCGTGCGCGGGAAGTTCGACCCGGAGAAGCTGTGCAAGAAGATCTGG
TGCAAGGCCGGCAAGATCATCAAGGAGATCCTCATCGTCGACGTCTGGCCGCCGCCGCTG
CCGCAGCCGCCGCCGCCGTGCAAGCCGCCGCCGTGCGAGAAGCCTCCGGAGGACTGCAAG
CCCAAGCCCTGCCATTGCTGCAGCTGCGAGAAGCCCAAGCCCAAGCCCAAGCCCTGCCAC
TGCGAGAAGCCCAAGCCCTGTCACTGCGAGAAGCCCAAGCCATGCGAGAAGCCGCCGCCG
TGCAAGCCGGAGGAGCCGCCGAAGCCGCCGCCGGAGAAGCCGCCGCCGAAGCCGGAGTGC
AAGCTGGTGCCGTACCCTTACCCGGTGCCGTACCCGTACGCCGGGCAGTGGTGCTGCCCA
AAGCCTGAGCCGCCGAAGCCGCCGCCGCCCGTCTGCCCGCCGCCGCCGTGGTGCTACACC
GAGGACAACGCCAACGCCTGCTCCATCATGTGA

Protein

211 aa

>Os04t0401000-02 Similar to Pi21 protein.
MGILVILVDLQCCRCDAKIRKVLGCLEEEYCIEKVEYDVKNNRVIVRGKFDPEKLCKKIW
CKAGKIIKEILIVDVWPPPLPQPPPPCKPPPCEKPPEDCKPKPCHCCSCEKPKPKPKPCH
CEKPKPCHCEKPKPCEKPPPCKPEEPPKPPPEKPPPKPECKLVPYPYPVPYPYAGQWCCP
KPEPPKPPPPVCPPPPWCYTEDNANACSIM*

5'UTR

chr04:19836806..19836886 (- strand) : 81 bp

CDS

chr04:19836356..19836437 (- strand) : 82 bp

chr04:19835735..19836219 (- strand) : 485 bp

chr04:19835501..19835566 (- strand) : 66 bp

3'UTR

chr04:19835208..19835500 (- strand) : 293 bp

FASTA

>Os04t0401000-02 class=Sequence position=chr04:19835208..19836886 (- strand)
ATGCATCGCC TCCATTATTC ATGCTTCGAT TCTCCATGCT TTCCTCTACT GCTCATTGGT AACATTCGGC AAATTTGACA
GGTGAGCTCA GTATTTTAAA TCTTAATGTA GTACTTTGGT GTGCTAATCT TTGCTCTGTT CAAAAGAGAA TTCTGGTTTC
TTTGCTATTT TGAAAAGAGA ATTTTCGTTA CAGGACTTCA ACTTCCATAA TACTTTTTTT TATAATTAAG GCATGATATA
TATCTTCTTT CTGAATTCCA CGGGAATTGC ACTTTTTCCT GAGAAATTTG TAAAGAGCAT GCCTGTTAAT TGCAAGGGGC
CCCTAACTCT GTTATGAGAA AAGAGAACTA TATAAGATGC TCAATAAGCA CCTCTTTTTT TTTTTCTGTT AACTGACCAA
AGCCTGTCTA TCTGCATTTT TTTTTGTTTT TTGTTTTTCT TGTGTGCAGA TGGGTATATT GGTCATCTTG GTGGACCTGC
AATGCTGCCG CTGCGATGCC AAGATCAGGA AGGTCCTGGG CTGCCTTGAA GGTATAATAA ATTCTGCCCG AATCGTCCAT
GTTTGATTGA ATTTTCAAGG CTAATCAGCA GTGTTCCTGC TCAATTGGGA GCAAAACCTC TGTTAAAAAG GGTGTGTTTG
AATGAATATA ATTGAATATG AACGCAGAGG AGTACTGCAT CGAGAAGGTG GAGTACGACG TGAAGAACAA CAGGGTGATC
GTGCGCGGGA AGTTCGACCC GGAGAAGCTG TGCAAGAAGA TCTGGTGCAA GGCCGGCAAG ATCATCAAGG AGATCCTCAT
CGTCGACGTC TGGCCGCCGC CGCTGCCGCA GCCGCCGCCG CCGTGCAAGC CGCCGCCGTG CGAGAAGCCT CCGGAGGACT
GCAAGCCCAA GCCCTGCCAT TGCTGCAGCT GCGAGAAGCC CAAGCCCAAG CCCAAGCCCT GCCACTGCGA GAAGCCCAAG
CCCTGTCACT GCGAGAAGCC CAAGCCATGC GAGAAGCCGC CGCCGTGCAA GCCGGAGGAG CCGCCGAAGC CGCCGCCGGA
GAAGCCGCCG CCGAAGCCGG AGTGCAAGCT GGTGCCGTAC CCTTACCCGG TGCCGTACCC GTACGCCGGG CAGTGGTGCT
GCCCAAAGCC TGAGCCGCCG AAGCCGCCGC CGGAGCCACC GAAGGAGCCG GAGCCGCCGA AGCCGTGCGG GTGCTCGCAC
GCCTTCGTGT GCGTCTGCAA GCCGGCGCCG CCGCCGCCGC CGCCGTGCGG GTGCTCGGGG GGCCACGGGA ACTGCGGCTG
CGGCATCAGG CCGTGGCCGC CGCAGGTGTG GCCGCCGCCG CCCGTCTGCC CGCCGCCGCC GTGGTGCTAC ACCGAGGACA
ACGCCAACGC CTGCTCCATC ATGTGATGGC CGGCCGGCGG TCGGCGTCGA TCACGATCAT CTCTGCTGCT TAATTTCCTT
GCTTGCTACT ACCTCTGCTC CTTTCCTTGC CTCGGAAATC GGAATAAATT AAACACGAGG CTGATCGATG TGTTTGTAAT
TAATCCATGG TGTTTGTGTT GTGTGCTGTG TGGGCTGTAT AATAATTAAT TACAGTATGT TCATGTAAAT TTGTTTGTTT
GTTTGTTTAT GTTGTTCGAT ATGTATAATT ATGTACAATA ATTAATCGTG GAGAGGCTCA CTAAACTCAT AAACTGTAG