Os04t0409900-01

Locus

Os04g0409900

Description

Plant neutral invertase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NIN4

CGSNL Gene Name

NEUTRAL/ALKALINE INVERTASE 4

Oryzabase Gene Symbol Synonym(s)

OsNIN4

Oryzabase Gene Name Synonym(s)

neutral/alkaline invertase 4

Transcript Evidence

AK288558 (DDBJ, Best hit)

Protein Evidence

B4FS06 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: catalytic activity (GO:0003824)

Functional domain (InterPro)

Plant neutral invertase (IPR006937)

Six-hairpin glycosidase-like (IPR008928)

Full-length cDNA

J090047H18 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0409900-01)

Others

Oryzabase (14669)

KEGG (Os04t0409900-01)

Transcript

2115 bp

>Os04t0409900-01 Plant neutral invertase family protein.
ATCGCGCGCGCGGCGTGGACATGTGTAGCTTTTCTCGGCTCCACCTCCGATCCCCTCGCT
CTCTCCCCTCCCCTCCCATCCCCCACCCCCTCCCTCGTCGTCGTCCGCCCGCGCCCGCGC
GCGCGCCACTGCCATCCCAACACCGGAGCAAGCGAACGAACAAACCACGACGCGAGGTTG
ACGGCCGCCGTGTCAGCCTAGAACACCGGACACCTCACCTGATCACCTCCCCGAGAAGCC
AAGCTCTAGCCAGCCAGCCAGCCAGCCGCTCCCCATGGAGATCGCGCGGGTGGTCGCGCC
GCCACTGCGCCTCGCGTGGTGCCCCGCGTCGAGGCGGTGGGGGAGGAGGAAGGGGAGGCC
CCCGTGTCCCAGCTCGCTGCCGGGGCCGCGCCACGACCACGCCGTGAAGAGGCCAGGCGG
CGAGGCGGCGGGCGGGAGGAGCGTCAACGGCGCCGCTCCGGCTCCAGCTCCCGCTCCCGC
GGAGGCGCCGGCGAAGGCGCCGCAGAGGAGGCAGAGGCGCGGGCCTCATGACGTGGAGGA
CGAGGCGTGGGGGCTGCTCCGGGAGTCGGTGGTGCGCTACTGCGGCAGCCCCGTGGGCAC
GATCGCCGCGTGCGACCCCAACGACGCCAGCCCGCTCAACTACGACCAGGTGTTCATCCG
GGACTTCGTGCCCTCGGGCATCGCCTTCCTGCTCAAGGGGGACTACGAGATCGTCCGCAA
CTTCATCCTGCACACCCTCCAGCTCCAGAGCTGGGAGAAAACGATGGACTGCCACAGTCC
AGGTCAAGGGTTGATGCCAGCAAGTTTCAAGGTGCGTGTTGTTCCACTTGACGGGGACGA
TGATGTAACTGAGGAAGTCCTGGATCCTGATTTCGGGGAGGCTGCAATAGGACGTGTGGC
ACCAGTTGATTCTGGTTTATGGTGGATCATATTGCTGAGAGCATACGGAAAATGTTCAGG
CGATCTGTCGGTTCAGGAGAGAATTGATGTCCAGACTGGAATAAAGATGATCTTGAAGCT
CTGCTTAGCTGATGGCTTCGACATGTTTCCCACCTTGCTTGTTACTGATGGCTCATGCAT
GATAGATCGTCGAATGGGAATCCATGGACACCCATTGGAAATTCAGGCACTTTTCTATTC
AGCTCTCTTGTGTGCACGTGAGATGCTTACCCCAGAAGATGGATCAGCTGACTTGATTCG
TGCCCTAAATAGCAGGCTTATTGCACTCTCTTTTCATATCAGAGAGTATTATTGGCTTGA
CAAGAGAAAGCTAAATGAGATATATCGATACAAAACAGAGGAGTATTCTTATGACGCTGT
CAACAAGTTTAACATATATCCAGATCAGATTCCTCCCTGGCTGGTTGAATGGATCCCTCC
TAAAGGGGGTTACTTCATTGGAAACCTGCAGCCAGCTCATATGGATTTTCGGTTCTTTTC
TCTTGGGAACTTGTGGTCAATAGTAAGTAGTTTGGCAACATCCCACCAGTCTGATGCTAT
TTTGGATCTGGTTGAAGCCAAATGGTCTGATTTAGTGGCGGATATGCCAATGAAGATATG
CTATCCTGCTCTTGAGGATCAGGAGTGGAAATTCATTACAGGGAGCGACCCTAAAAATAC
GGCTTGGTCTTACCATAATGGAGGTTCCTGGCCAACACTATTGTGGCAGCTCACAGTAGC
ATGTATCAAGGTGGACCGGTCAGAGATTGCAGCAAAAGCTGTGGAGGTTGCTGAGCGACG
TATTGCCAATGATAAATGGCCTGAATACTACGATACCAAACGTGCACGATTCATCGGGAA
GCAGTCTCGGCTTTTTCAGACATGGACCATTGCCGGTTTTCTCGTGGCCAAGCAGCTGTT
AGAAAACCCTGATAAATCGAGAATACTGTGGAACAACGAGGATGAGGAAATTCTCAACGC
TATGAATCGCATGACTGATGCATCCAATCTGAAGAGGCGGCGTGGCAGGAAAGGACTCAA
GAAGACTTATATTGTGTAAGTCCAGAAATAGTTTCGGCCTATCGTCATATGTGTAGAATA
TGTTATAGGAATGATGAGTTCTTGTTGTACATAAGTACATTTTTGAAGATGGAAACCTAA
TCTCACATTTTTGTC

CDS

1725 bp

>Os04t0409900-01 Plant neutral invertase family protein.
ATGGAGATCGCGCGGGTGGTCGCGCCGCCACTGCGCCTCGCGTGGTGCCCCGCGTCGAGG
CGGTGGGGGAGGAGGAAGGGGAGGCCCCCGTGTCCCAGCTCGCTGCCGGGGCCGCGCCAC
GACCACGCCGTGAAGAGGCCAGGCGGCGAGGCGGCGGGCGGGAGGAGCGTCAACGGCGCC
GCTCCGGCTCCAGCTCCCGCTCCCGCGGAGGCGCCGGCGAAGGCGCCGCAGAGGAGGCAG
AGGCGCGGGCCTCATGACGTGGAGGACGAGGCGTGGGGGCTGCTCCGGGAGTCGGTGGTG
CGCTACTGCGGCAGCCCCGTGGGCACGATCGCCGCGTGCGACCCCAACGACGCCAGCCCG
CTCAACTACGACCAGGTGTTCATCCGGGACTTCGTGCCCTCGGGCATCGCCTTCCTGCTC
AAGGGGGACTACGAGATCGTCCGCAACTTCATCCTGCACACCCTCCAGCTCCAGAGCTGG
GAGAAAACGATGGACTGCCACAGTCCAGGTCAAGGGTTGATGCCAGCAAGTTTCAAGGTG
CGTGTTGTTCCACTTGACGGGGACGATGATGTAACTGAGGAAGTCCTGGATCCTGATTTC
GGGGAGGCTGCAATAGGACGTGTGGCACCAGTTGATTCTGGTTTATGGTGGATCATATTG
CTGAGAGCATACGGAAAATGTTCAGGCGATCTGTCGGTTCAGGAGAGAATTGATGTCCAG
ACTGGAATAAAGATGATCTTGAAGCTCTGCTTAGCTGATGGCTTCGACATGTTTCCCACC
TTGCTTGTTACTGATGGCTCATGCATGATAGATCGTCGAATGGGAATCCATGGACACCCA
TTGGAAATTCAGGCACTTTTCTATTCAGCTCTCTTGTGTGCACGTGAGATGCTTACCCCA
GAAGATGGATCAGCTGACTTGATTCGTGCCCTAAATAGCAGGCTTATTGCACTCTCTTTT
CATATCAGAGAGTATTATTGGCTTGACAAGAGAAAGCTAAATGAGATATATCGATACAAA
ACAGAGGAGTATTCTTATGACGCTGTCAACAAGTTTAACATATATCCAGATCAGATTCCT
CCCTGGCTGGTTGAATGGATCCCTCCTAAAGGGGGTTACTTCATTGGAAACCTGCAGCCA
GCTCATATGGATTTTCGGTTCTTTTCTCTTGGGAACTTGTGGTCAATAGTAAGTAGTTTG
GCAACATCCCACCAGTCTGATGCTATTTTGGATCTGGTTGAAGCCAAATGGTCTGATTTA
GTGGCGGATATGCCAATGAAGATATGCTATCCTGCTCTTGAGGATCAGGAGTGGAAATTC
ATTACAGGGAGCGACCCTAAAAATACGGCTTGGTCTTACCATAATGGAGGTTCCTGGCCA
ACACTATTGTGGCAGCTCACAGTAGCATGTATCAAGGTGGACCGGTCAGAGATTGCAGCA
AAAGCTGTGGAGGTTGCTGAGCGACGTATTGCCAATGATAAATGGCCTGAATACTACGAT
ACCAAACGTGCACGATTCATCGGGAAGCAGTCTCGGCTTTTTCAGACATGGACCATTGCC
GGTTTTCTCGTGGCCAAGCAGCTGTTAGAAAACCCTGATAAATCGAGAATACTGTGGAAC
AACGAGGATGAGGAAATTCTCAACGCTATGAATCGCATGACTGATGCATCCAATCTGAAG
AGGCGGCGTGGCAGGAAAGGACTCAAGAAGACTTATATTGTGTAA

Protein

575 aa

>Os04t0409900-01 Plant neutral invertase family protein.
MEIARVVAPPLRLAWCPASRRWGRRKGRPPCPSSLPGPRHDHAVKRPGGEAAGGRSVNGA
APAPAPAPAEAPAKAPQRRQRRGPHDVEDEAWGLLRESVVRYCGSPVGTIAACDPNDASP
LNYDQVFIRDFVPSGIAFLLKGDYEIVRNFILHTLQLQSWEKTMDCHSPGQGLMPASFKV
RVVPLDGDDDVTEEVLDPDFGEAAIGRVAPVDSGLWWIILLRAYGKCSGDLSVQERIDVQ
TGIKMILKLCLADGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALLCAREMLTP
EDGSADLIRALNSRLIALSFHIREYYWLDKRKLNEIYRYKTEEYSYDAVNKFNIYPDQIP
PWLVEWIPPKGGYFIGNLQPAHMDFRFFSLGNLWSIVSSLATSHQSDAILDLVEAKWSDL
VADMPMKICYPALEDQEWKFITGSDPKNTAWSYHNGGSWPTLLWQLTVACIKVDRSEIAA
KAVEVAERRIANDKWPEYYDTKRARFIGKQSRLFQTWTIAGFLVAKQLLENPDKSRILWN
NEDEEILNAMNRMTDASNLKRRRGRKGLKKTYIV*

5'UTR

chr04:20256143..20256416 (+ strand) : 274 bp

CDS

chr04:20256417..20256890 (+ strand) : 474 bp

chr04:20257358..20257523 (+ strand) : 166 bp

chr04:20257600..20257811 (+ strand) : 212 bp

chr04:20258060..20258553 (+ strand) : 494 bp

chr04:20258638..20258686 (+ strand) : 49 bp

chr04:20258828..20259157 (+ strand) : 330 bp

3'UTR

chr04:20259158..20259273 (+ strand) : 116 bp

FASTA

>Os04t0409900-01 class=Sequence position=chr04:20256143..20259273 (+ strand)
ATCGCGCGCG CGGCGTGGAC ATGTGTAGCT TTTCTCGGCT CCACCTCCGA TCCCCTCGCT CTCTCCCCTC CCCTCCCATC
CCCCACCCCC TCCCTCGTCG TCGTCCGCCC GCGCCCGCGC GCGCGCCACT GCCATCCCAA CACCGGAGCA AGCGAACGAA
CAAACCACGA CGCGAGGTTG ACGGCCGCCG TGTCAGCCTA GAACACCGGA CACCTCACCT GATCACCTCC CCGAGAAGCC
AAGCTCTAGC CAGCCAGCCA GCCAGCCGCT CCCCATGGAG ATCGCGCGGG TGGTCGCGCC GCCACTGCGC CTCGCGTGGT
GCCCCGCGTC GAGGCGGTGG GGGAGGAGGA AGGGGAGGCC CCCGTGTCCC AGCTCGCTGC CGGGGCCGCG CCACGACCAC
GCCGTGAAGA GGCCAGGCGG CGAGGCGGCG GGCGGGAGGA GCGTCAACGG CGCCGCTCCG GCTCCAGCTC CCGCTCCCGC
GGAGGCGCCG GCGAAGGCGC CGCAGAGGAG GCAGAGGCGC GGGCCTCATG ACGTGGAGGA CGAGGCGTGG GGGCTGCTCC
GGGAGTCGGT GGTGCGCTAC TGCGGCAGCC CCGTGGGCAC GATCGCCGCG TGCGACCCCA ACGACGCCAG CCCGCTCAAC
TACGACCAGG TGTTCATCCG GGACTTCGTG CCCTCGGGCA TCGCCTTCCT GCTCAAGGGG GACTACGAGA TCGTCCGCAA
CTTCATCCTG CACACCCTCC AGCTCCAGGT GATCACCCGC CCTTTCGTGT CTCAACACTC GCTCTTAGAT TTTTGGTTGG
GTCCCAAACT GTCGAAAGAG AAGGACTAAT CACTAATGCT TATGCAATTG ATGGTGATGC TCCTAATAAT TGTACTGCAT
ACTAGTAGTA CTAGTAGTAG TGAAGAGGGA TGATTTGAAA TTGACAAGTG AGAAGTAAAG AAGCAAATGT AATTATACTT
GCAATTATGG CCAGCATAGT GACTGCAGAA GGACTAGCCA ACGAGGAACC GCCTACCAAA AGAATCGCAA CAATTTTATA
CATCGAGTTG CATAGATTGC TATAGACATG CTTTCATTTG CTGAAGTCAC CACCCACTTA ACAGTAGTGT CAAGAATTGT
GTTTCTAAGC ACCTTCTTGC TTAAATAAGT CATGTGTTTC CAATATTTAA ATCTGGAGAT CTTCTTCTCT TAAATCTGAT
TGTTAACATC TGCAGAGCTG GGAGAAAACG ATGGACTGCC ACAGTCCAGG TCAAGGGTTG ATGCCAGCAA GTTTCAAGGT
GCGTGTTGTT CCACTTGACG GGGACGATGA TGTAACTGAG GAAGTCCTGG ATCCTGATTT CGGGGAGGCT GCAATAGGAC
GTGTGGCACC AGTTGATTCT GGTGGGTATA GATGACGTTC CTTATCTCCT ATTTTGCGCA CAGCATAAAG ATGTGGCACT
TTAACAATGG TTTTCAGGTT TATGGTGGAT CATATTGCTG AGAGCATACG GAAAATGTTC AGGCGATCTG TCGGTTCAGG
AGAGAATTGA TGTCCAGACT GGAATAAAGA TGATCTTGAA GCTCTGCTTA GCTGATGGCT TCGACATGTT TCCCACCTTG
CTTGTTACTG ATGGCTCATG CATGATAGAT CGTCGAATGG GAATCCATGG ACACCCATTG GAAATTCAGG TAGCATGAAA
ATTTAACAGA GTGAAATATC ATAAGTTCAT ATAGCAAAGC AAACTTATAT GATCGGAGTT AGGCAGTAAA TGCATTTTGA
ATTATGGTAT TTATTACATG CTGGACTTGC AACAATTACA GTTCTGCTCT ATAACAGCAC ATATAGGACT ACAGTGTGCA
AATGTCATTC GGGAAATGGG GCATTATACG TTTGCTACTA ATTTATACAT GATGTTCATA TTTCCTTTCT TTTGTAGGCA
CTTTTCTATT CAGCTCTCTT GTGTGCACGT GAGATGCTTA CCCCAGAAGA TGGATCAGCT GACTTGATTC GTGCCCTAAA
TAGCAGGCTT ATTGCACTCT CTTTTCATAT CAGAGAGTAT TATTGGCTTG ACAAGAGAAA GCTAAATGAG ATATATCGAT
ACAAAACAGA GGAGTATTCT TATGACGCTG TCAACAAGTT TAACATATAT CCAGATCAGA TTCCTCCCTG GCTGGTTGAA
TGGATCCCTC CTAAAGGGGG TTACTTCATT GGAAACCTGC AGCCAGCTCA TATGGATTTT CGGTTCTTTT CTCTTGGGAA
CTTGTGGTCA ATAGTAAGTA GTTTGGCAAC ATCCCACCAG TCTGATGCTA TTTTGGATCT GGTTGAAGCC AAATGGTCTG
ATTTAGTGGC GGATATGCCA ATGAAGATAT GCTATCCTGC TCTTGAGGAT CAGGAGTGGA AATTCATTAC AGGGAGCGAC
CCTAAAAATA CGTGAGCCCT ATGATTATCA TGTAACCCGT GTAATTTAGA CTGTTTGGAT TTCATCTTAT TTGTTTTTTT
TCTCTTTCAA TGCAGGGCTT GGTCTTACCA TAATGGAGGT TCCTGGCCAA CACTATTGTG GCAGGTACTT GTGTTTCATT
GCTGATAAGT GTTCATTTGT CCAGTTTAGT GCCATGAAAA ATGAAACCTT GTCCATGTTT TGTTTGAATA TTGGAACCAG
TTTTTTCCTC CTGTTTAAAG TTTCCAATCA ACCCCTCATT TGCAGCTCAC AGTAGCATGT ATCAAGGTGG ACCGGTCAGA
GATTGCAGCA AAAGCTGTGG AGGTTGCTGA GCGACGTATT GCCAATGATA AATGGCCTGA ATACTACGAT ACCAAACGTG
CACGATTCAT CGGGAAGCAG TCTCGGCTTT TTCAGACATG GACCATTGCC GGTTTTCTCG TGGCCAAGCA GCTGTTAGAA
AACCCTGATA AATCGAGAAT ACTGTGGAAC AACGAGGATG AGGAAATTCT CAACGCTATG AATCGCATGA CTGATGCATC
CAATCTGAAG AGGCGGCGTG GCAGGAAAGG ACTCAAGAAG ACTTATATTG TGTAAGTCCA GAAATAGTTT CGGCCTATCG
TCATATGTGT AGAATATGTT ATAGGAATGA TGAGTTCTTG TTGTACATAA GTACATTTTT GAAGATGGAA ACCTAATCTC
ACATTTTTGT C

Locus: Os04g0409900

Loading...

Locus: Os04g0409900

Loading...