Os04t0418000-01

Locus

Os04g0418000

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SDH5

CGSNL Gene Name

SUCCINATE DEHYDROGENASE SUBUNIT 5

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

SUCCINATE:UBIQUINONE OXIDOREDUCTASE

Transcript Evidence

AK106155 (DDBJ, Best hit)

AK061030 (DDBJ, Best hit)

AK099124 (DDBJ, Best hit)

AK119714 (DDBJ, Best hit)

Protein Evidence

Q7X6C3 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

001-208-A04 (Online Clone Ordering)

006-204-H01 (Online Clone Ordering)

J023039I07 (Online Clone Ordering)

002-157-F05 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0418000-01)

Others

Oryzabase (8751)

Transcript

1116 bp

>Os04t0418000-01 Conserved hypothetical protein.
GAAACctcgcccttcgtctccgcctccgtcgcctccatctcgccgcgatccctctccccg
gcgatggccgccgccctccgctcCTCCTGCGCCGCCGCGCGCCGTCTGCTCCGGATCTCC
CCGGCCGCGCTGTCCACCCTCACCGCCGCCTCCTCCCGCCCCGCCGCGGTGGCGCCCCTC
GCGCGCCCGATCGCCGCCGCCGCCGTCTCAGGTGGCAACAATGCCTTTTCATGGAACTTG
AGGCGCTTGTTCAGCTCAAATGAAAAGCATCTGCCGGCGATATCTGACCCAGAAGTTGAA
TCTGCGTTTAAGGATTTGATGGCTGCTAGCTGGACTGGACTTCCAGATTCTCTTGTAATT
GAAGCAAAGAAAGCTGCATCCAAAGCTACGGATGATAAGGCTGGGAAAGAGGCTTTGCTA
AATGTATTTCGTGCAGCTGAGGCATGTGAAGAATTTGGTGGAGTTCTAGTCACCCTAAGA
ATGGCTCTAGATGATCTTTGTGGTATAACTGGTGAGAATGTGGGCCCCTTGCCTGGTTAT
ATAGAAGATGCTGTTAAATCTGCATATAAGCGTTACATGAAATATCTGGAATCATTTGGC
CCGGAGGAAAATTATCTACGTAAGAAAGTGGAGAATGAGTTGGGGACTAAAATGATACAC
CTGAAAATGCGGTGCAGTGGTGTAGGGTCCGAGTGGGGAAAGATCACCCTGATTGGCACC
TCAGGCATCTCAGGATCCTATGTCGAGCTAAGGGCATGAGGAAAGTCTGCAGATCATAAC
CATGGCAGAACATCGTTTTCTGAGGGAAGGATGCATATCAGAACAAGGTGTTCCGTTTCT
CTTTTCTTCTTACTGTGTAGCTACCTTGCCAATAACAAGGAGATCATCAAACAGATGTGC
ACTTAAAGTAATTCAGTGTGCTCCAGACCTTCCTGCTGTAATAAGAACGTGTTTCTGGGG
TTCACGTCGATTTGTTTTTGCTCCAGTCATGGTGGTGCGTGAAGCATGTAGATTCAGTTG
ATTCCTTGCATGAGCCGTGAATTGTTTGTTCAAGCTCCTACTCTGTATGGCTCTATTGAA
CTCAGAAGTAGCTTAATCGGTGTTCAGATTCCTTGC

CDS

696 bp

>Os04t0418000-01 Conserved hypothetical protein.
atggccgccgccctccgctcCTCCTGCGCCGCCGCGCGCCGTCTGCTCCGGATCTCCCCG
GCCGCGCTGTCCACCCTCACCGCCGCCTCCTCCCGCCCCGCCGCGGTGGCGCCCCTCGCG
CGCCCGATCGCCGCCGCCGCCGTCTCAGGTGGCAACAATGCCTTTTCATGGAACTTGAGG
CGCTTGTTCAGCTCAAATGAAAAGCATCTGCCGGCGATATCTGACCCAGAAGTTGAATCT
GCGTTTAAGGATTTGATGGCTGCTAGCTGGACTGGACTTCCAGATTCTCTTGTAATTGAA
GCAAAGAAAGCTGCATCCAAAGCTACGGATGATAAGGCTGGGAAAGAGGCTTTGCTAAAT
GTATTTCGTGCAGCTGAGGCATGTGAAGAATTTGGTGGAGTTCTAGTCACCCTAAGAATG
GCTCTAGATGATCTTTGTGGTATAACTGGTGAGAATGTGGGCCCCTTGCCTGGTTATATA
GAAGATGCTGTTAAATCTGCATATAAGCGTTACATGAAATATCTGGAATCATTTGGCCCG
GAGGAAAATTATCTACGTAAGAAAGTGGAGAATGAGTTGGGGACTAAAATGATACACCTG
AAAATGCGGTGCAGTGGTGTAGGGTCCGAGTGGGGAAAGATCACCCTGATTGGCACCTCA
GGCATCTCAGGATCCTATGTCGAGCTAAGGGCATGA

Protein

231 aa

>Os04t0418000-01 Conserved hypothetical protein.
MAAALRSSCAAARRLLRISPAALSTLTAASSRPAAVAPLARPIAAAAVSGGNNAFSWNLR
RLFSSNEKHLPAISDPEVESAFKDLMAASWTGLPDSLVIEAKKAASKATDDKAGKEALLN
VFRAAEACEEFGGVLVTLRMALDDLCGITGENVGPLPGYIEDAVKSAYKRYMKYLESFGP
EENYLRKKVENELGTKMIHLKMRCSGVGSEWGKITLIGTSGISGSYVELRA*

5'UTR

chr04:20653716..20653778 (+ strand) : 63 bp

CDS

chr04:20653779..20653926 (+ strand) : 148 bp

chr04:20654763..20655067 (+ strand) : 305 bp

chr04:20655188..20655373 (+ strand) : 186 bp

chr04:20656704..20656760 (+ strand) : 57 bp

3'UTR

chr04:20656761..20657117 (+ strand) : 357 bp

FASTA

>Os04t0418000-01 class=Sequence position=chr04:20653716..20657117 (+ strand)
GAAACctcgc ccttcgtctc cgcctccgtc gcctccatct cgccgcgatc cctctccccg gcgatggccg ccgccctccg
ctcCTCCTGC GCCGCCGCGC GCCGTCTGCT CCGGATCTCC CCGGCCGCGC TGTCCACCCT CACCGCCGCC TCCTCCCGCC
CCGCCGCGGT GGCGCCCCTC GCGCGCCCGA TCGCCGCCGC CGCCGTCTCA GGTCCTCCTC CCATCTGACT CTTCTTGTTC
TTGCTGTTTC GCTACCTTGT AGTCGATGAT GATGATACCT CCTTCAGTTC GTGTTTGGGG TGGATTGGGC TGACGATGCG
TGTTTAGGGT TCTGTGCGTG CTGCTTGCTT GTGCAGGCTG ATTCCAGATT TGTGTTTGCC GTGTGGTAGA ATCTGATTGT
TTTGGGGGAT TTCAACTCCG AGAGATTGGA TTTGAGATGC TATCGTGTGT GGTGATAATA ATTTGCCAGG AAGTTATTGG
TTGTAAAGAT ACAAGGTTCG GGGGTGGCGG GGGTGCCAAT TGTTGGTCGC TGCGTTGTAG TTAAAGCATC AATAGGAAAA
ATGTTAACAC TCTGTGTATA AAGGTTTACA TTTCCAAGCT GATCCTGAAC TTCACTTCAG ATGTGTTGTC CTGAAGTGTT
GTTCCTGCTC GTGTTGCATC TTTGATCACA TAATAACAGG CAATATTGTT TAAAATGATG TTGCTGCAAA CCAAGAATAA
CTGGTTCAAA ACAGTGAGAT TTTTCACTTG ATTCTGAAGT AAATAAGCTT ATTATTCTCT AACCTTTTTG TCAAAGAATA
CGTTGACGGG AAAAAAAACC ACTGTTTGTC CTTTATATGC CATAAGTGTA TAAGAATGGG AGAAGCATGG TAAGAGGATG
GTTGACAAAG AGAAATATAT TTGGAAGAGT CATTGATGTC ATCTTGCCTT TTGTGGTCTT CATTTTGCTG CAATGTAACA
CTGTTGCCTT AGTTCAAAAT TGTACATACC CCAATATCAA ATTTTCTGTG CTCAATGTTG TTTAACTTAT ACTTGTTTTA
AATTCAGGTG GCAACAATGC CTTTTCATGG AACTTGAGGC GCTTGTTCAG CTCAAATGAA AAGCATCTGC CGGCGATATC
TGACCCAGAA GTTGAATCTG CGTTTAAGGA TTTGATGGCT GCTAGCTGGA CTGGACTTCC AGATTCTCTT GTAATTGAAG
CAAAGAAAGC TGCATCCAAA GCTACGGATG ATAAGGCTGG GAAAGAGGCT TTGCTAAATG TATTTCGTGC AGCTGAGGCA
TGTGAAGAAT TTGGTGGAGT TCTAGTCACC CTAAGAATGG CTCTAGATGA TCTTTGTGGT ATAACTGGTG AGGTCAGTAC
CTAATCACAT ATATCCCTCA TTGATGTATT GCTTTCTGCC AATTTGGGGG ATCAGTCATC AGTGTCTCTT TCTTATGCTT
ATTACTTGTT GTACCACTCC TTGCTCTTGC AGAATGTGGG CCCCTTGCCT GGTTATATAG AAGATGCTGT TAAATCTGCA
TATAAGCGTT ACATGAAATA TCTGGAATCA TTTGGCCCGG AGGAAAATTA TCTACGTAAG AAAGTGGAGA ATGAGTTGGG
GACTAAAATG ATACACCTGA AAATGCGGTG CAGTGGTGTA GGGTCCGAGT GGGGAAAGGT ACACTCTTAT GTTACCTATC
CCTGTTGTAT ATTTTACCTT TGTGACAGCT TCTGTGGTAG ATTTGCATTT GACAAGTCCA TGGATTGTGG GTCCTGATGT
ATGCTTTAGT GCGGATTTAT GCTATCATTT TTAATGGTTT CTTATGATTG TATTCAAGAT GTTGTGTAGA TGTTATTTTC
AGCGTAGAAG CAGAGTTAGT ATGTGCAGTT TCTGCTATCA CAAATGTGTT ATTTGTGTTT AAGAATATAT TCCTTTCTAT
GGCTAAGGAT CATTTAATAT CAGACTGCAT CTTGGGTCAT CACTTGTCAT TGGAGTAGGT TGTACTATGT CAGGACAGTC
CTTTATTATT ATTTTGCTTG ATACAAAGGG AGAAATGAGA TTCTACATCC ATCtttttac ttgacgatta gaacattgtc
acagcctcca gggctcatgt ttgatcatat cttttctaat tgaatatgta tataaaaatc attaaaacta aaactacatt
aaagtgtttt tcacgacaaa tctactacag tcattttcac atcaaatctt aatgtttttg caaatatccg tgatttagga
ttttgaggtt tgaccacata catcctaaaa aatcatgtat ttgagaacgg aaggagtaGC TTAGAGTGAA TATAAACACC
TCAACCTCAT CCAAAAAAAC CAAGTGAATG AACTAGGACC ATCATCTTGT CTATCTATTC ATTTGGTTTG AAGAAGGGAA
ATTGCACAGG TAAGTTGAGA TTTGAGAACA ATTGCAGCGC ATTCTCATTT TACCAAGTCT TGTGCTAGAT ATACTTCAAA
TAAATGTAAA TGTAAAATGG AAGCTAAATC AGTTTATCCT GCACAGCTAT ACACTGTGTA AGGCTCGGTA ATAAAAGGTA
CATGCTTGTT ATTTTGTTGT TTGCTTGCAC AGAGACCTGT AGTACTTCCA ATTGAGCACT GGCATACACC CCTGGTACCA
TGTAACATGT TAACTTTCAA GAAGGGGGTA TGCTTATCTT ATTTTATCTG TAATTAGTCA AAAAAAAAGG AGCTGTTCAT
TTACCATTGT CACCACTTAC TTCAAACCTT ATAAGGGCTT ATAGGGGTGT TTGCTTCCAG CCAATTTGGA ACATATGATT
TAGACCGAGT TTGAATTGTT TTCAAATTAA AATAGACGAG TTCATGCTTG ACGTTGTAAC ATGTGTGGAA TAATATTTTC
ATGTCAGTGT ATAGCTGATA TGCTCGTTCC TCCTTGCTTC GACTGGAGTT AGAAGGACAA ATCTATATCC AACACCTGAA
GCTCATGATT TATTTATTTC ACTTGCAGAT CACCCTGATT GGCACCTCAG GCATCTCAGG ATCCTATGTC GAGCTAAGGG
CATGAGGAAA GTCTGCAGAT CATAACCATG GCAGAACATC GTTTTCTGAG GGAAGGATGC ATATCAGAAC AAGGTGTTCC
GTTTCTCTTT TCTTCTTACT GTGTAGCTAC CTTGCCAATA ACAAGGAGAT CATCAAACAG ATGTGCACTT AAAGTAATTC
AGTGTGCTCC AGACCTTCCT GCTGTAATAA GAACGTGTTT CTGGGGTTCA CGTCGATTTG TTTTTGCTCC AGTCATGGTG
GTGCGTGAAG CATGTAGATT CAGTTGATTC CTTGCATGAG CCGTGAATTG TTTGTTCAAG CTCCTACTCT GTATGGCTCT
ATTGAACTCA GAAGTAGCTT AATCGGTGTT CAGATTCCTT GC

Locus: Os04g0418000

Loading...

Locus: Os04g0418000

Loading...