Os04t0423600-01

Locus

Os04g0423600

Description

SET domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET18, SDG738

Oryzabase Gene Name Synonym(s)

SET protein 18

Transcript Evidence

AK065331 (DDBJ, Best hit)

Protein Evidence

Q01L87 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

SET domain (IPR001214)

Full-length cDNA

J013000M22 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0423600-01)

Others

Oryzabase (13383)

Transcript

3860 bp

>Os04t0423600-01 SET domain containing protein.
GTAGGGCCCAGCCACCCAGCCCAGGCAAGCCAAAGCACACCCCCCTCTCGTCTCGTCGTC
TCCGTTGCCGGCACGCACGCCGCCGCCGCCTCGCTCCCCTCTCTTCTGGCGCGGTTGCGG
TGCCGCCGCCCCGTCCTACGACCCTGCTGCGGGGACGCGGCTTCAAGGAGGACCTGACAA
AATGGCAATGGGGATGAGAGCCCGGGAATCTGTGAACATGTCGGAGGACCTAACTCAGGC
CATTGCGCCTTATGCTACTGCCCTGCACGATGCGTCGCTCCAGTCCCACTGTTCGTCATG
CTTCCACCGCATACCGGCTCAATCCCCCCACGACATGTCTTGCACGATGTGCGGTTCTGT
TCGATATTGCTGCTCGGACTGCTTGATCTCGGACTGTGAAGTGCATTCATCTTCTGGTGA
ATGTTGCTTCTTTGTGAAACATCTCAGGGAAGCCTCCCCATCCACTCTTACCGAAGAAAC
GAGCGATATCCGTGCTGCTCTCCGCCTTCTCTATTCGCTTGAGACGCGTGGTCTTGTTTC
ATCTGATTCGGTCAGCAGCTCCAATAGGATCGGCGGGCTTTCTGCAAGTGGTATTAGGGA
GGTTCTGGAGGAGGGTGGGGAGATTGCCGAGGGGGTGCTGGAGGGGAGTTTGTTGATGTT
GTCTGCCAGAAAATCGAGGATGAAGAACTATGTTGGTCTCTCCAATGGCTTGACGATAGA
GAAGGTGGCATTGTGGGCAGTGATGACAAATAGTGTTGAGGTGCAGATTAGCGAAGAGCA
GTCTCTGGGGATTGCTGTTTATGGCCCTAGTTTCTCATGGTTCAATCATAGTTGCTGTCC
CAGTGCTTCTTACCGATTTGTATTGGTTCCACAGAATGAAGGGTGTACTTCAAACAAACC
AGAATCATGTGTAGTTCCTGTTAGCAAAGGAGCTGCGCCAGATGCGTGGCATGCTTGGCA
GAATGAAGAAGCTGGTTTTGCTCATGCTCAATGTAAATATGGTCCACGAGTTGTTGTTCG
CTGCACAAAGCCAATCAACAAGGGAGATGAAGTTTTCATAACATACATTGATCTTCTTCA
GACAAGGGAAGCAAGGCTTTCAGATCTGTGGTCAAAGTATAAATTCATTTGTTCTTGCGA
GCTTTGTACTGCACTACCAAAACCATATGTGGATCTTATTCTGAATTGTGATGCTAGGAA
CTTGAAATCGCCACATAATGCTGTTACAGACCCAGCAATTGAGGATTTGGACAATAACTT
ACAACAGGCAATATCTGAATACTCATTCCTTGATGACTCTAAAGCTTGCTGTGATGTAAT
TGAAAGCATGCTTTCAGAAAACTTGATGAATGATTTGCAGCAAGAGGAACTTTCACCAAG
GAAATACATACTACACCCCCTACACCATATCAGTGTCAGCAGTTTCATGATACTTGCCTC
TGCATACCGGTGCAGTGCCTTCAAATCAAGCACTGATAATTTGCATGGAGAAAATTGTGA
TTTCATTTTCAGAATGACCAAAGCTGCAGCAGCTTATTCAATAGTTCTTGCAGGGGCTAC
ACATCACTTGTTTTTATCTGAATGTTCCTTTGTGACCCTTCTGTCGCATTTTTTGCTAAG
CACTGGACAGTCCATATTAGATTTTGCTGAATGTATTAAGGGAGAAACAAGGAAAAACAT
GCCTGAAGCTATCTTCAGCTTTGCTTCATGTTCAACAAATTCGGCAAAACATGATTCTGT
GCGGTACAATCAATTCAGATCAACTTGTGAGAAGTTTGGCAAGCCCTTGTTATCTTTATC
GTTGCAGTGCTGGCCATTTTTAGCCCAAGGCTTACCCTGCCTGGAAAAGATAAAGAACCC
CATAGATTTCAGTTGGCTTGGTCCAGCAATATTTCAGGCTTTCCAGCTTTCTGAGGAAGA
TTCTTTCAACCTTTCTGGTAAACATGCGCCAGCAACTCTCATCGAGCAACAGAAAGAGTG
CATTCTGAGCTTAGCTGTTTGCTGCATCACCTACAGCAAATACCTTGCAAGTATATGCTA
TGGTCCAGAACATTATTTGGCAAATCGTGCTAAAGATCTGCTTGAATGTATCAATCATGT
ACAATGATCTCTCTGTGATATATCTCTGGAGCTGATGTTTGATGTGCTCTATTGTCTTTA
TCAAGGCAGAAGATGAGTTTAAAGTTACAACACCTATCCCATAAAGGAATCACCGAGGTA
TTGGAAGAATCATCATCAGATTGGGCTGTGAAGATCTTCGATTTAAATAATGGTGCAAAA
GTTTACTCAAGAATAAAGGCTGAGATGCTCTTCAAGTGATAACAATAATTGTTTTGGACT
TGGAAGACAATGTGACAGCTGCTTGCTATGCATAAAACAGAGTGTCTTATTCAATATAAT
TGGACGAAATTACCCTCTCTGAAGTTATTGGAAGCGACGTTGACTTGTAACAGCTTCAGA
TCCTTACAAATGGACAGCAATCATGGATTTCTGTTGAGTCATGTGGAATATTATCTTCAT
TTTGCCAAGTGCGTAAGCAAAATGAATGGTTATCAGTTGCAGTTCATTCTAGTATCCATA
TGACCACAGTTTGATGCAGCTGCAAGCCTGCAGCAATTATTTTGTGTTTGTTAGTTGCTC
ATTCCTACATCAATTAACTTCTTCCGAAATGGCAGATGAGTATGATCGCAGCAGCTACAG
AAGGTCTGGTGCTGATGACGAGGAAGGTGGCTACAACAAGACCAACACTGGAGATTATGG
CCGCAGCGGTGACGACTACGGTCGTGACACTGGCCTCTTCAACGAGTCCGGCAACGACGA
CAATGAGAGTGGCTACAAGAACACCAACACTGATGAATATGGCAGCACTGGTAGCTACAA
CAAGTCCAACACCGACGACTTAACTGGCGGCTTCAACAAATCCGGCACAGATGACTACAG
TGGTGGCGGCGGCTACAACAAATCTggcgccgacgactacagcagcagcggtggctacag
caaatccggcactgacaactacagcgggagcggcggctacaacaaatccggcaacaatga
ctacagtggcagtggtggtggctacaacTAGTCCAGCGCTGGCGACTATGGCAGCGAGTA
CAAGGACTCCAGCACCGGCGACTATGGTCGTGGTGACGAATACAAGAAATCAAGCTCAGA
CGACTATGATGGTGGCTACAAGAAGTCAAGCAGCAACGATGATGGCTATGGCGGAAGCGG
CTACAGCAAGCCGAGCACCGGCGACTACGACAGTGGTAAGAACGCCTCCAACACTGATGG
ATATGGTGGCAGTGGCTACAACAAATCAAGCACAGACAACTCTGAGAGTGGCTACAACAA
GTCCGGCACCGGTGAATATGGCAGCGGCGGCGGCTACAACAAATCAAGCACGGACAACTA
TGAGAGCGGCTACAACAAGTCCGGCACCGGCGACTATGGCAGCGGTGGTGGCTACGACAA
GTCTGACGCCGGTGACTACACTGGTGGCTACAACAAGTCGAGCACTGATGAGTACGCAAC
CGGAAGAGGCAAGACCAGTTCTGACGACTACTAGATAATTATCGCTTATCAGGAAAGCGA
ATCAGGGTACTCTTGATGCTGAAGTACTAAATATGCTCGAATACAGTTGGTCCTTGCTAA
AAAGGATTTCGTATGTATTCCCTCTTATTTACAGGATGGGTTGATCAGTTTGTCTCTGAT
ATGCAAGGTTGATCACACATCTCAGAGGATGTGTGATGTGCGTAATATGCTCTGTATGTG
TATGTACCTGAACGAAAATGTAATACTACTCTGCTATGTTTGCACATGAATAAAACGTGA
TATATGCAGTAGTATCAAGC

CDS

1926 bp

>Os04t0423600-01 SET domain containing protein.
ATGGCAATGGGGATGAGAGCCCGGGAATCTGTGAACATGTCGGAGGACCTAACTCAGGCC
ATTGCGCCTTATGCTACTGCCCTGCACGATGCGTCGCTCCAGTCCCACTGTTCGTCATGC
TTCCACCGCATACCGGCTCAATCCCCCCACGACATGTCTTGCACGATGTGCGGTTCTGTT
CGATATTGCTGCTCGGACTGCTTGATCTCGGACTGTGAAGTGCATTCATCTTCTGGTGAA
TGTTGCTTCTTTGTGAAACATCTCAGGGAAGCCTCCCCATCCACTCTTACCGAAGAAACG
AGCGATATCCGTGCTGCTCTCCGCCTTCTCTATTCGCTTGAGACGCGTGGTCTTGTTTCA
TCTGATTCGGTCAGCAGCTCCAATAGGATCGGCGGGCTTTCTGCAAGTGGTATTAGGGAG
GTTCTGGAGGAGGGTGGGGAGATTGCCGAGGGGGTGCTGGAGGGGAGTTTGTTGATGTTG
TCTGCCAGAAAATCGAGGATGAAGAACTATGTTGGTCTCTCCAATGGCTTGACGATAGAG
AAGGTGGCATTGTGGGCAGTGATGACAAATAGTGTTGAGGTGCAGATTAGCGAAGAGCAG
TCTCTGGGGATTGCTGTTTATGGCCCTAGTTTCTCATGGTTCAATCATAGTTGCTGTCCC
AGTGCTTCTTACCGATTTGTATTGGTTCCACAGAATGAAGGGTGTACTTCAAACAAACCA
GAATCATGTGTAGTTCCTGTTAGCAAAGGAGCTGCGCCAGATGCGTGGCATGCTTGGCAG
AATGAAGAAGCTGGTTTTGCTCATGCTCAATGTAAATATGGTCCACGAGTTGTTGTTCGC
TGCACAAAGCCAATCAACAAGGGAGATGAAGTTTTCATAACATACATTGATCTTCTTCAG
ACAAGGGAAGCAAGGCTTTCAGATCTGTGGTCAAAGTATAAATTCATTTGTTCTTGCGAG
CTTTGTACTGCACTACCAAAACCATATGTGGATCTTATTCTGAATTGTGATGCTAGGAAC
TTGAAATCGCCACATAATGCTGTTACAGACCCAGCAATTGAGGATTTGGACAATAACTTA
CAACAGGCAATATCTGAATACTCATTCCTTGATGACTCTAAAGCTTGCTGTGATGTAATT
GAAAGCATGCTTTCAGAAAACTTGATGAATGATTTGCAGCAAGAGGAACTTTCACCAAGG
AAATACATACTACACCCCCTACACCATATCAGTGTCAGCAGTTTCATGATACTTGCCTCT
GCATACCGGTGCAGTGCCTTCAAATCAAGCACTGATAATTTGCATGGAGAAAATTGTGAT
TTCATTTTCAGAATGACCAAAGCTGCAGCAGCTTATTCAATAGTTCTTGCAGGGGCTACA
CATCACTTGTTTTTATCTGAATGTTCCTTTGTGACCCTTCTGTCGCATTTTTTGCTAAGC
ACTGGACAGTCCATATTAGATTTTGCTGAATGTATTAAGGGAGAAACAAGGAAAAACATG
CCTGAAGCTATCTTCAGCTTTGCTTCATGTTCAACAAATTCGGCAAAACATGATTCTGTG
CGGTACAATCAATTCAGATCAACTTGTGAGAAGTTTGGCAAGCCCTTGTTATCTTTATCG
TTGCAGTGCTGGCCATTTTTAGCCCAAGGCTTACCCTGCCTGGAAAAGATAAAGAACCCC
ATAGATTTCAGTTGGCTTGGTCCAGCAATATTTCAGGCTTTCCAGCTTTCTGAGGAAGAT
TCTTTCAACCTTTCTGGTAAACATGCGCCAGCAACTCTCATCGAGCAACAGAAAGAGTGC
ATTCTGAGCTTAGCTGTTTGCTGCATCACCTACAGCAAATACCTTGCAAGTATATGCTAT
GGTCCAGAACATTATTTGGCAAATCGTGCTAAAGATCTGCTTGAATGTATCAATCATGTA
CAATGA

Protein

642 aa

>Os04t0423600-01 SET domain containing protein.
MAMGMRARESVNMSEDLTQAIAPYATALHDASLQSHCSSCFHRIPAQSPHDMSCTMCGSV
RYCCSDCLISDCEVHSSSGECCFFVKHLREASPSTLTEETSDIRAALRLLYSLETRGLVS
SDSVSSSNRIGGLSASGIREVLEEGGEIAEGVLEGSLLMLSARKSRMKNYVGLSNGLTIE
KVALWAVMTNSVEVQISEEQSLGIAVYGPSFSWFNHSCCPSASYRFVLVPQNEGCTSNKP
ESCVVPVSKGAAPDAWHAWQNEEAGFAHAQCKYGPRVVVRCTKPINKGDEVFITYIDLLQ
TREARLSDLWSKYKFICSCELCTALPKPYVDLILNCDARNLKSPHNAVTDPAIEDLDNNL
QQAISEYSFLDDSKACCDVIESMLSENLMNDLQQEELSPRKYILHPLHHISVSSFMILAS
AYRCSAFKSSTDNLHGENCDFIFRMTKAAAAYSIVLAGATHHLFLSECSFVTLLSHFLLS
TGQSILDFAECIKGETRKNMPEAIFSFASCSTNSAKHDSVRYNQFRSTCEKFGKPLLSLS
LQCWPFLAQGLPCLEKIKNPIDFSWLGPAIFQAFQLSEEDSFNLSGKHAPATLIEQQKEC
ILSLAVCCITYSKYLASICYGPEHYLANRAKDLLECINHVQ*

5'UTR

chr04:20948752..20948918 (- strand) : 167 bp

chr04:20948330..20948343 (- strand) : 14 bp

CDS

chr04:20947565..20948329 (- strand) : 765 bp

chr04:20947410..20947449 (- strand) : 40 bp

chr04:20947231..20947331 (- strand) : 101 bp

chr04:20946301..20946399 (- strand) : 99 bp

chr04:20945000..20945920 (- strand) : 921 bp

3'UTR

chr04:20944942..20944999 (- strand) : 58 bp

chr04:20944594..20944647 (- strand) : 54 bp

chr04:20944394..20944472 (- strand) : 79 bp

chr04:20943935..20944141 (- strand) : 207 bp

chr04:20943650..20943811 (- strand) : 162 bp

chr04:20941830..20942299 (- strand) : 470 bp

chr04:20941065..20941787 (- strand) : 723 bp

FASTA

>Os04t0423600-01 class=Sequence position=chr04:20941065..20948918 (- strand)
GTAGGGCCCA GCCACCCAGC CCAGGCAAGC CAAAGCACAC CCCCCTCTCG TCTCGTCGTC TCCGTTGCCG GCACGCACGC
CGCCGCCGCC TCGCTCCCCT CTCTTCTGGC GCGGTTGCGG TGCCGCCGCC CCGTCCTACG ACCCTGCTGC GGGGACGCGG
CTTCAAGGTG AGCAGACCCC TCGCCGTCTC AAGCACTCGT GATATGTTAA CTAGAGCTAC TAACTAACTA GGCTGGTTTG
GTTTGGTTTG GTTCTCTTCC GTGTTGCTCT AAAAGGAAAA ATCCCGCCAT GAAATGAACT GGTTAGGCAG GGGTAGATTT
GTTGAGGAGT TTCTGGTAAG GTTGTAGTAA TAAGTTAAGT TTGGGGGCAA AAAGGTCGTA GGGGTGTAAG CCGTCAGAAT
GCTGAATTTA GACCCGGATA ATTCGATAGA TTAAGCAGAG GGGAAATCCC TTTTCAATTT TGATTAGTAT TGGGTAATCT
TGTTATTCCG GGAGATTTGC AATAATGACA CTACAAACAT TAACCTTTGC TTATTCCTGA TTTTAATTTT GTGCAAAATA
AAACTTTCGC TGCAGGAGGA CCTGACAAAA TGGCAATGGG GATGAGAGCC CGGGAATCTG TGAACATGTC GGAGGACCTA
ACTCAGGCCA TTGCGCCTTA TGCTACTGCC CTGCACGATG CGTCGCTCCA GTCCCACTGT TCGTCATGCT TCCACCGCAT
ACCGGCTCAA TCCCCCCACG ACATGTCTTG CACGATGTGC GGTTCTGTTC GATATTGCTG CTCGGACTGC TTGATCTCGG
ACTGTGAAGT GCATTCATCT TCTGGTGAAT GTTGCTTCTT TGTGAAACAT CTCAGGGAAG CCTCCCCATC CACTCTTACC
GAAGAAACGA GCGATATCCG TGCTGCTCTC CGCCTTCTCT ATTCGCTTGA GACGCGTGGT CTTGTTTCAT CTGATTCGGT
CAGCAGCTCC AATAGGATCG GCGGGCTTTC TGCAAGTGGT ATTAGGGAGG TTCTGGAGGA GGGTGGGGAG ATTGCCGAGG
GGGTGCTGGA GGGGAGTTTG TTGATGTTGT CTGCCAGAAA ATCGAGGATG AAGAACTATG TTGGTCTCTC CAATGGCTTG
ACGATAGAGA AGGTGGCATT GTGGGCAGTG ATGACAAATA GTGTTGAGGT GCAGATTAGC GAAGAGCAGT CTCTGGGGAT
TGCTGTTTAT GGCCCTAGTT TCTCATGGTT CAATCATAGT TGCTGTCCCA GTGCTTCTTA CCGATTTGTA TTGGTTCCAC
AGAATGAAGG GTGTACTTCA AACAAACCAG AATCATGTGT AGTTCCTGTT AGCAAAGGAG CTGCGCCAGA TGCGGTAATG
GAGTTTAACT GATGGTTTTA TTTAGTATTC ACTAAACTTT TGCTTGCATC ATTTGGAGGT ATCTATTACA CACTGTAGAG
TGAGTTATTG GACTCTGTAT TGGTTGCAGT GGCATGCTTG GCAGAATGAA GAAGCTGGTT TTGCTCATGG TACTTTTTTA
TACATGTTAT TTTGATTCTG GAACTTCTAA AAGCTTCATT TTAAGCTTGT ACCATCTCTA TCTTCAGCTC AATGTAAATA
TGGTCCACGA GTTGTTGTTC GCTGCACAAA GCCAATCAAC AAGGGAGATG AAGTTTTCAT AACATACATT GATCTTCTTC
AGACAAGGGT ACTGTTTTCC TTTCACCCAA CAGTTCCAGT GTTTCACAAT AGAAGTGTAT CATTTAATAG CTTTGGAGAA
TCAAACCAAG GTTTGCTTGT TCCATGCTTT TGTAATTTGT TTGCTACTGT ATTCCCTGGG ACACCAAATG TTTAGTCTTT
ACATCACAAG ATTTTCCTGT TTAAGGTTAG AGAACTGTAG AAAATGTAAT TTTATGTGCA CCTACTTTAG TTTGCATTTG
CAGATTGTAA AGTACTGTTA CAGAATTGGC TTGGTAAAGG TCCAAGGACT GAGGGTAAGG CACTCTTTGC TAAGTCCAAG
GACCAAGGGT AGGACACTGT ATGAACAGAG TGGGATGGTT GACAGAGAGG AAGAGACTAG AGACTGATAC TATTATTTTG
CTTAGGTCAA TTAAGTATAT TGCATCCCTT TTATAGGGAT CATTTGGTTA ACCCCTAGGA TATATTTCTA ACTTAATGGA
ACAAACTAAC CTGAGGAAAA CCATCCAATC TAATTTTCGC ATATTGCTTT CTTGGATCTT AATCCCATAT GCCCATAGCG
GAGTGCAATA GTGCATGTAG GTTACACATT TATATTTCAA CATCTTAGCA TAGGTTGATG TACAGCATTA CCAGTTTTTC
TCATTGATGA TCAATTGATG CATGCTGATT GACTCAATGA AATATTCAGC TAATGTTATG AGTGTTTGAT TAATTAAGGT
CCATTATATT TTGTGATGTT AAAAAAGAAA GCCTTGTTTT CTTATCTATT TGCACTAGTA GTTTCTGACC TTTTCCCCTA
CTGTGATATT GTCGCCACAC TCGTAACTAA CCTTTCCAGG AAGCAAGGCT TTCAGATCTG TGGTCAAAGT ATAAATTCAT
TTGTTCTTGC GAGCTTTGTA CTGCACTACC AAAACCATAT GTGGATCTTA TTCTGAATGT AAGATTCAAA CTCTGAAGAA
AATACTGTCA GTAATTCGCC ATGCACTTTA TTTCACAAAT TTAAGTTTAT CATTACAAGT TTATTCACCT GCCAATATCG
TACAACGTTC TGAGAATTGT TAGGGACATT TCACTGCTTT GCTACTCTGT CTTTTGTACC ATCCTTTTGA ATTGAACTTA
TGCATTTCAA CTTCTAGATA AATCTCACCC AACATTAGTT GAACTGTTGA ACGAATAAAC CACAAGTTCA CAAGTCAATA
ATATCAACAA TTTCTAGTCG ATTTTATGCA TTCATGCTAG CAAAATGTTT CTTGTCTTCT AAAAATTAAT AAAAACAAGC
TAATACTTTC TTCATGCTGA CATGTCTGTG CTGATCAGTG TGATGCTAGG AACTTGAAAT CGCCACATAA TGCTGTTACA
GACCCAGCAA TTGAGGATTT GGACAATAAC TTACAACAGG CAATATCTGA ATACTCATTC CTTGATGACT CTAAAGCTTG
CTGTGATGTA ATTGAAAGCA TGCTTTCAGA AAACTTGATG AATGATTTGC AGCAAGAGGA ACTTTCACCA AGGAAATACA
TACTACACCC CCTACACCAT ATCAGTGTCA GCAGTTTCAT GATACTTGCC TCTGCATACC GGTGCAGTGC CTTCAAATCA
AGCACTGATA ATTTGCATGG AGAAAATTGT GATTTCATTT TCAGAATGAC CAAAGCTGCA GCAGCTTATT CAATAGTTCT
TGCAGGGGCT ACACATCACT TGTTTTTATC TGAATGTTCC TTTGTGACCC TTCTGTCGCA TTTTTTGCTA AGCACTGGAC
AGTCCATATT AGATTTTGCT GAATGTATTA AGGGAGAAAC AAGGAAAAAC ATGCCTGAAG CTATCTTCAG CTTTGCTTCA
TGTTCAACAA ATTCGGCAAA ACATGATTCT GTGCGGTACA ATCAATTCAG ATCAACTTGT GAGAAGTTTG GCAAGCCCTT
GTTATCTTTA TCGTTGCAGT GCTGGCCATT TTTAGCCCAA GGCTTACCCT GCCTGGAAAA GATAAAGAAC CCCATAGATT
TCAGTTGGCT TGGTCCAGCA ATATTTCAGG CTTTCCAGCT TTCTGAGGAA GATTCTTTCA ACCTTTCTGG TAAACATGCG
CCAGCAACTC TCATCGAGCA ACAGAAAGAG TGCATTCTGA GCTTAGCTGT TTGCTGCATC ACCTACAGCA AATACCTTGC
AAGTATATGC TATGGTCCAG AACATTATTT GGCAAATCGT GCTAAAGATC TGCTTGAATG TATCAATCAT GTACAATGAT
CTCTCTGTGA TATATCTCTG GAGCTGATGT TTGATGTGCT CTATTGTCTT TATCAAGGTG AGCAGCTTAC TTTTAAGATT
GTTGTAGGAC TGAACTGATA GTTTCTTTTA CAAGCAGAAC TTATCAGCAA TTTTTGTCAA GGGGGAGTTA CATGGATGCT
ATTAACGTTT TCTGTTTTAT TGTGATTAAC AAAGCTACTA TAGATTAACA GTGACAAAAT CAGTTTGTGG GAACAGTCTG
TGCAATGCTT CCGCGGTTTT GGTTCACTTA CGATTTTTAT GTGGCGCTGT AACAGAATTG TCTTGAATTG TTGTTAAAAT
GGATTTGAGG ATCTCTGTCC AAACATTTCA GGCAGAAGAT GAGTTTAAAG TTACAACACC TATCCCATAA AGGAATCACC
GAGGTGTAAG GTTTTCCAAA CCTCTATATC TGAAATTAAT CACAGTACAT ATCAAATGGT GCCTTTTCTA TTATAACTTT
TTTTCTGGTC AGGATCAAAA TCTTTCTTGT TTGTTACTCT TGGAAGATTG GAAGAATCAT CATCAGATTG GGCTGTGAAG
ATCTTCGATT TAAATAATGG TGCAAAAGTT TACTCAAGAA TAAAGGTCCA AAACAAAGCT AAATTCTTCG TTGCTTTAGA
AAGAGTCAAT TTGTGATTGG AATATACTCT CAATTCCTTG GTTGCAATCT GCATCTTGTC GGCAGCTCAT GGAAGAATAA
TTCCATCTAG CAATAATTCA AGATATTTGC AGTATTTAAT TGAGAAAAAC AAATGAATAT TTTTAAGGGA AATAAAGAAC
AATAGCGCTA CTTTTTCAAG GCATAAAAAT TGTTCTTATA AGAAACACTC CTGACAGGCT GAGATGCTCT TCAAGTGATA
ACAATAATTG TTTTGGACTT GGAAGACAAT GTGACAGCTG CTTGCTATGC ATAAAACAGA GTGTCTTATT CAATATAATT
GGACGAAATT ACCCTCTCTG AAGTTATTGG AAGCGACGTT GACTTGTAAC AGCTTCAGAT CCTTACAAAT GGACAGCAAT
CATGGATTTC TGTTGAGTCA TGTGGTGTGT TCTCTTTATT TACTTTTCTT TTCTGCCTTT CAATCTTGGT GTGACCAATA
GAATTTTCCT TCTTCCGTAT TATTACTTTA TAAGTTAACT TTTAGCCAAT TTCAACCATA TATGCAGGAA TATTATCTTC
ATTTTGCCAA GTGCGTAAGC AAAATGAATG GTTATCAGTT GCAGTTCATT CTAGTATCCA TATGACCACA GTTTGATGCA
GCTGCAAGCC TGCAGCAATT ATTTTGTGTT TGTTAGTTGC TCATTCCTAC ATCAATTAAC TTCTTCCGAG TAAGTGAAGG
TAACTTGTGG CTCAATTATA GAACTGCAAG AAATACTTTT CAGCAGCAAT ATTCAAAATA TTACTGAGGT GCATGTTTTA
GCTAATAGCT TTAGCTAGCC ACTCATTTAG ATTCAACTAC AGTCTCCTGC AACCACAAAA GAAACAACTA CAGTTGCTGA
TAAACAGATG ACACTATGAC ACTGTGATAG CAAGTTGAAT TAGTGATAAT GCCATAATTT GCCAAACAAT ATTGCTGATT
CTGGTGACAA ATAATTGTTG GAATATGCTT TCGCATTTTC CTTCCCCCGT AATGTTTCTT CTACTGACAT AATGAGTGGG
GAGTTAAACT GTCTCCATTA ATAGGCCAGC TTGTGAGTTA AACTGTCTCC ATTAATGGGC CGGTTTGTCT TTTCCCGGCA
CGGATCTGTC TACTTTAAGC TAGTGGTGCT GATAAAATCT AAAATTTCTC TTATGTGTGT TAAAATGTCT CGTATGTTCG
TGGATATCAC AACTTGCTTG GCATTGTCTG TGATGTGCCG TGTACATGCA AGCATGCAAC TTGAAAGTAG GAGTTGTCTG
GTTGGACTGC GTTGAAATAT TTGTAATGTG TAGGGTTCTT CCTTTTCTTT ACGGTTTAAG CTTTTGCAGT GAACTACTTG
AGTGCATAAA CGGGTGTAGT TTGCAAAATA AAAATTTCCT GTATTGTCCA GATGTCATGA TTTTGAGACA TGTGAGCTAA
TTTTCCATTT AGTATAATGA AACTATACAA GCTTGATGAG GTTTGCGGCG TTTGCCTGAT CAAAGCATGT AGTGCCTTTT
CTTTTTTTCC CTTGCTCTGC TTAGGCAATT TCTGCATCCA CTTGTGCAAG ATGTGATTAT CCATTGCTTT GCAGGTAATG
TCCGTGCCTA ATGATCAATT AACGAATATA GGACCCACAT ACAAATATGG GAAAAATCAC TTCGAACATG TGGACAGGAG
AAGTGGTTTT CCGGTGTGTT TACATCGACT AAAATAATTT GTGGCACATT TGAAAATTTT CTGTATTGAA GCATGTATTT
TTGTGGTCAG TGAATTGCTC CAAGTCCAAT TTGCCCATTT GCCCCTTGCT TCCAAATATC ACAAAAAAAA AATCCTCACC
TAGACTACAA ACAAACTGCT TTCAGTTATT GATTGTGCAC CATATTATAT GGCCATCTGT AATTCTGATT GCTGGAGCTC
TGATCGGATA CAACAATTTA TTTCTCAAAA TGCATAAATG TACCTAGCTA CTGCTATAAA TAACTCCTAC TGCACCTCTT
GCAAATCATA GTGCAACTAA GCATCTCCCT GATTTTTGTG TGCTCTCTTT TCATTTTAGA ATGGCAGATG AGTATGATCG
CAGCAGCTAC AGAAGGTCTG GTGCTGATGA CGAGGAAGGT GGCTACAACA AGACCAACAC TGGAGATTAT GGCCGCAGCG
GTGACGACTA CGGTCGTGAC ACTGGCCTCT TCAACGAGTC CGGCAACGAC GACAATGAGA GTGGCTACAA GAACACCAAC
ACTGATGAAT ATGGCAGCAC TGGTAGCTAC AACAAGTCCA ACACCGACGA CTTAACTGGC GGCTTCAACA AATCCGGCAC
AGATGACTAC AGTGGTGGCG GCGGCTACAA CAAATCTggc gccgacgact acagcagcag cggtggctac agcaaatccg
gcactgacaa ctacagcggg agcggcggct acaacaaatc cggcaacaat gactacagtg gcagtggtgg tggctacaac
TAGTCCAGCG CTGGCGACTA TGGCAGCGAG TACAAGGACT CCAGCACCGT CGACTATGTC GTGTCTGGCG ATTACAAGGA
CTCCAGCACC GGCGACTATG GTCGTGGTGA CGAATACAAG AAATCAAGCT CAGACGACTA TGATGGTGGC TACAAGAAGT
CAAGCAGCAA CGATGATGGC TATGGCGGAA GCGGCTACAG CAAGCCGAGC ACCGGCGACT ACGACAGTGG TAAGAACGCC
TCCAACACTG ATGGATATGG TGGCAGTGGC TACAACAAAT CAAGCACAGA CAACTCTGAG AGTGGCTACA ACAAGTCCGG
CACCGGTGAA TATGGCAGCG GCGGCGGCTA CAACAAATCA AGCACGGACA ACTATGAGAG CGGCTACAAC AAGTCCGGCA
CCGGCGACTA TGGCAGCGGT GGTGGCTACG ACAAGTCTGA CGCCGGTGAC TACACTGGTG GCTACAACAA GTCGAGCACT
GATGAGTACG CAACCGGAAG AGGCAAGACC AGTTCTGACG ACTACTAGAT AATTATCGCT TATCAGGAAA GCGAATCAGG
GTACTCTTGA TGCTGAAGTA CTAAATATGC TCGAATACAG TTGGTCCTTG CTAAAAAGGA TTTCGTATGT ATTCCCTCTT
ATTTACAGGA TGGGTTGATC AGTTTGTCTC TGATATGCAA GGTTGATCAC ACATCTCAGA GGATGTGTGA TGTGCGTAAT
ATGCTCTGTA TGTGTATGTA CCTGAACGAA AATGTAATAC TACTCTGCTA TGTTTGCACA TGAATAAAAC GTGATATATG
CAGTAGTATC AAGC

Locus: Os04g0423600

Loading...

Locus: Os04g0423600

Loading...