Os04t0423600-02

Locus

Os04g0423600

Description

Similar to OSIGBa0076I14.5 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET18, SDG738

Oryzabase Gene Name Synonym(s)

SET protein 18

Transcript Evidence

AK100500 (DDBJ, Best hit)

Protein Evidence

Q01L87 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J023099G24 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0423600-02)

RiceXPro (AK100500)

Others

Oryzabase (13383)

KEGG (Os04t0423600-02)

Transcript

2209 bp

>Os04t0423600-02 Similar to OSIGBa0076I14.5 protein.
AAGCACACCCCCCTCTCGTCTCGTCGTCTCCGTTGCCGGCACGCACGCCGCCGCCGCCTC
GCTCCCCTCTCTTCTGGCGCGGTTGCGGTGCCGCCGCCCCGTCCTACGACCCTGCTGCGG
GGACGCGGCTTCAAGGAGGACCTGACAAAATGGCAATGGGGATGAGAGCCCGGGAATCTG
TGAACATGTCGGAGGACCTAACTCAGGCCATTGCGCCTTATGCTACTGCCCTGCACGATG
CGTCGCTCCAGTCCCACTGTTCGTCATGCTTCCACCGCATACCGGCTCAATCCCCCCACG
ACATGTCTTGCACGATGTGCGGTTCTGTTCGATATTGCTGCTCGGACTGCTTGATCTCGG
ACTGTGAAGTGCATTCATCTTCTGGTGAATGTTGCTTCTTTGTGAAACATCTCAGGGAAG
CCTCCCCATCCACTCTTACCGAAGAAACGAGCGATATCCGTGCTGCTCTCCGCCTTCTCT
ATTCGCTTGAGACGCGTGGTCTTGTTTCATCTGATTCGGTCAGCAGCTCCAATAGGATCG
GCGGGCTTTCTGCAAGTGGTATTAGGGAGGTTCTGGAGGAGGGTGGGGAGATTGCCGAGG
GGGTGCTGGAGGGGAGTTTGTTGATGTTGTCTGCCAGAAAATCGAGGATGAAGAACTATG
TTGGTCTCTCCAATGGCTTGACGATAGAGAAGGTGGCATTGTGGGCAGTGATGACAAATA
GTGTTGAGAATGAAGGGTGTACTTCAAACAAACCAGAATCATGTGTAGTTCCTGTTAGCA
AAGGAGCTGCGCCAGATGCGGTAATGGAGTTTAACTGATGGTTTTATTTAGTATTCACTA
AACTTTTGCTTGCATCATTTGGAGGTATCTATTACACACTGTAGAGTGAGTTATTGGACT
CTGTATTGGTTGCAGTGGCATGCTTGGCAGAATGAAGAAGCTGGTTTTGCTCATGCTCAA
TGTAAATATGGTCCACGAGTTGTTGTTCGCTGCACAAAGCCAATCAACAAGGGAGATGAA
GTTTTCATAACATACATTGATCTTCTTCAGACAAGGTGTGATGCTAGGAACTTGAAATCG
CCACATAATGCTGTTACAGACCCAGCAATTGAGGATTTGGACAATAACTTACAACAGGCA
ATATCTGAATACTCATTCCTTGATGACTCTAAAGCTTGCTGTGATGTAATTGAAAGCATG
CTTTCAGAAAACTTGATGAATGATTTGCAGCAAGAGGAACTTTCACCAAGGAAATACATA
CTACACCCCCTACACCATATCAGTGTCAGCAGTTTCATGATACTTGCCTCTGCATACCGG
TGCAGTGCCTTCAAATCAAGCACTGATAATTTGCATGGAGAAAATTGTGATTTCATTTTC
AGAATGACCAAAGCTGCAGCAGCTTATTCAATAGTTCTTGCAGGGGCTACACATCACTTG
TTTTTATCTGAATGTTCCTTTGTGACCCTTCTGTCGCATTTTTTGCTAAGCACTGGACAG
TCCATATTAGATTTTGCTGAATGTATTAAGGGAGAAACAAGGAAAAACATGCCTGAAGCT
ATCTTCAGCTTTGCTTCATGTTCAACAAATTCGGCAAAACATGATTCTGTGCGGTACAAT
CAATTCAGATCAACTTGTGAGAAGTTTGGCAAGCCCTTGTTATCTTTATCGTTGCAGTGC
TGGCCATTTTTAGCCCAAGGCTTACCCTGCCTGGAAAAGATAAAGAACCCCATAGATTTC
AGTTGGCTTGGTCCAGCAATATTTCAGGCTTTCCAGCTTTCTGAGGAAGATTCTTTCAAC
CTTTCTGGTAAACATGCGCCAGCAACTCTCATCGAGCAACAGAAAGAGTGCATTCTGAGC
TTAGCTGTTTGCTGCATCACCTACAGCAAATACCTTGCAAGTATATGCTATGGTCCAGAA
CATTATTTGGCAAATCGTGCTAAAGATCTGCTTGAATGTATCAATCATGTACAATGATCT
CTCTGTGATATATCTCTGGAGCTGATGTTTGATGTGCTCTATTGTCTTTATCAAGGTGAG
CAGCTTACTTTTAAGATTGTTGTAGGACTGAACTGATAGTTTCTTTTACAAGCAGAACTT
ATCAGCAATTTTTGTCAAGGGGGAGTTACATGGATGCTATTAACGTTTTCTGTTTTATTG
TGATTAACAAAGCTACTATAGATTAACAGTGACAAAATCAGTTTGTGGG

CDS

669 bp

>Os04t0423600-02 Similar to OSIGBa0076I14.5 protein.
ATGGCAATGGGGATGAGAGCCCGGGAATCTGTGAACATGTCGGAGGACCTAACTCAGGCC
ATTGCGCCTTATGCTACTGCCCTGCACGATGCGTCGCTCCAGTCCCACTGTTCGTCATGC
TTCCACCGCATACCGGCTCAATCCCCCCACGACATGTCTTGCACGATGTGCGGTTCTGTT
CGATATTGCTGCTCGGACTGCTTGATCTCGGACTGTGAAGTGCATTCATCTTCTGGTGAA
TGTTGCTTCTTTGTGAAACATCTCAGGGAAGCCTCCCCATCCACTCTTACCGAAGAAACG
AGCGATATCCGTGCTGCTCTCCGCCTTCTCTATTCGCTTGAGACGCGTGGTCTTGTTTCA
TCTGATTCGGTCAGCAGCTCCAATAGGATCGGCGGGCTTTCTGCAAGTGGTATTAGGGAG
GTTCTGGAGGAGGGTGGGGAGATTGCCGAGGGGGTGCTGGAGGGGAGTTTGTTGATGTTG
TCTGCCAGAAAATCGAGGATGAAGAACTATGTTGGTCTCTCCAATGGCTTGACGATAGAG
AAGGTGGCATTGTGGGCAGTGATGACAAATAGTGTTGAGAATGAAGGGTGTACTTCAAAC
AAACCAGAATCATGTGTAGTTCCTGTTAGCAAAGGAGCTGCGCCAGATGCGGTAATGGAG
TTTAACTGA

Protein

223 aa

>Os04t0423600-02 Similar to OSIGBa0076I14.5 protein.
MAMGMRARESVNMSEDLTQAIAPYATALHDASLQSHCSSCFHRIPAQSPHDMSCTMCGSV
RYCCSDCLISDCEVHSSSGECCFFVKHLREASPSTLTEETSDIRAALRLLYSLETRGLVS
SDSVSSSNRIGGLSASGIREVLEEGGEIAEGVLEGSLLMLSARKSRMKNYVGLSNGLTIE
KVALWAVMTNSVENEGCTSNKPESCVVPVSKGAAPDAVMEFN*

5'UTR

chr04:20948752..20948886 (- strand) : 135 bp

chr04:20948330..20948343 (- strand) : 14 bp

CDS

chr04:20947751..20948329 (- strand) : 579 bp

chr04:20947547..20947636 (- strand) : 90 bp

3'UTR

chr04:20947410..20947546 (- strand) : 137 bp

chr04:20947231..20947331 (- strand) : 101 bp

chr04:20944768..20945920 (- strand) : 1153 bp

FASTA

>Os04t0423600-02 class=Sequence position=chr04:20944768..20948886 (- strand)
AAGCACACCC CCCTCTCGTC TCGTCGTCTC CGTTGCCGGC ACGCACGCCG CCGCCGCCTC GCTCCCCTCT CTTCTGGCGC
GGTTGCGGTG CCGCCGCCCC GTCCTACGAC CCTGCTGCGG GGACGCGGCT TCAAGGTGAG CAGACCCCTC GCCGTCTCAA
GCACTCGTGA TATGTTAACT AGAGCTACTA ACTAACTAGG CTGGTTTGGT TTGGTTTGGT TCTCTTCCGT GTTGCTCTAA
AAGGAAAAAT CCCGCCATGA AATGAACTGG TTAGGCAGGG GTAGATTTGT TGAGGAGTTT CTGGTAAGGT TGTAGTAATA
AGTTAAGTTT GGGGGCAAAA AGGTCGTAGG GGTGTAAGCC GTCAGAATGC TGAATTTAGA CCCGGATAAT TCGATAGATT
AAGCAGAGGG GAAATCCCTT TTCAATTTTG ATTAGTATTG GGTAATCTTG TTATTCCGGG AGATTTGCAA TAATGACACT
ACAAACATTA ACCTTTGCTT ATTCCTGATT TTAATTTTGT GCAAAATAAA ACTTTCGCTG CAGGAGGACC TGACAAAATG
GCAATGGGGA TGAGAGCCCG GGAATCTGTG AACATGTCGG AGGACCTAAC TCAGGCCATT GCGCCTTATG CTACTGCCCT
GCACGATGCG TCGCTCCAGT CCCACTGTTC GTCATGCTTC CACCGCATAC CGGCTCAATC CCCCCACGAC ATGTCTTGCA
CGATGTGCGG TTCTGTTCGA TATTGCTGCT CGGACTGCTT GATCTCGGAC TGTGAAGTGC ATTCATCTTC TGGTGAATGT
TGCTTCTTTG TGAAACATCT CAGGGAAGCC TCCCCATCCA CTCTTACCGA AGAAACGAGC GATATCCGTG CTGCTCTCCG
CCTTCTCTAT TCGCTTGAGA CGCGTGGTCT TGTTTCATCT GATTCGGTCA GCAGCTCCAA TAGGATCGGC GGGCTTTCTG
CAAGTGGTAT TAGGGAGGTT CTGGAGGAGG GTGGGGAGAT TGCCGAGGGG GTGCTGGAGG GGAGTTTGTT GATGTTGTCT
GCCAGAAAAT CGAGGATGAA GAACTATGTT GGTCTCTCCA ATGGCTTGAC GATAGAGAAG GTGGCATTGT GGGCAGTGAT
GACAAATAGT GTTGAGGTGC AGATTAGCGA AGAGCAGTCT CTGGGGATTG CTGTTTATGG CCCTAGTTTC TCATGGTTCA
ATCATAGTTG CTGTCCCAGT GCTTCTTACC GATTTGTATT GGTTCCACAG AATGAAGGGT GTACTTCAAA CAAACCAGAA
TCATGTGTAG TTCCTGTTAG CAAAGGAGCT GCGCCAGATG CGGTAATGGA GTTTAACTGA TGGTTTTATT TAGTATTCAC
TAAACTTTTG CTTGCATCAT TTGGAGGTAT CTATTACACA CTGTAGAGTG AGTTATTGGA CTCTGTATTG GTTGCAGTGG
CATGCTTGGC AGAATGAAGA AGCTGGTTTT GCTCATGGTA CTTTTTTATA CATGTTATTT TGATTCTGGA ACTTCTAAAA
GCTTCATTTT AAGCTTGTAC CATCTCTATC TTCAGCTCAA TGTAAATATG GTCCACGAGT TGTTGTTCGC TGCACAAAGC
CAATCAACAA GGGAGATGAA GTTTTCATAA CATACATTGA TCTTCTTCAG ACAAGGGTAC TGTTTTCCTT TCACCCAACA
GTTCCAGTGT TTCACAATAG AAGTGTATCA TTTAATAGCT TTGGAGAATC AAACCAAGGT TTGCTTGTTC CATGCTTTTG
TAATTTGTTT GCTACTGTAT TCCCTGGGAC ACCAAATGTT TAGTCTTTAC ATCACAAGAT TTTCCTGTTT AAGGTTAGAG
AACTGTAGAA AATGTAATTT TATGTGCACC TACTTTAGTT TGCATTTGCA GATTGTAAAG TACTGTTACA GAATTGGCTT
GGTAAAGGTC CAAGGACTGA GGGTAAGGCA CTCTTTGCTA AGTCCAAGGA CCAAGGGTAG GACACTGTAT GAACAGAGTG
GGATGGTTGA CAGAGAGGAA GAGACTAGAG ACTGATACTA TTATTTTGCT TAGGTCAATT AAGTATATTG CATCCCTTTT
ATAGGGATCA TTTGGTTAAC CCCTAGGATA TATTTCTAAC TTAATGGAAC AAACTAACCT GAGGAAAACC ATCCAATCTA
ATTTTCGCAT ATTGCTTTCT TGGATCTTAA TCCCATATGC CCATAGCGGA GTGCAATAGT GCATGTAGGT TACACATTTA
TATTTCAACA TCTTAGCATA GGTTGATGTA CAGCATTACC AGTTTTTCTC ATTGATGATC AATTGATGCA TGCTGATTGA
CTCAATGAAA TATTCAGCTA ATGTTATGAG TGTTTGATTA ATTAAGGTCC ATTATATTTT GTGATGTTAA AAAAGAAAGC
CTTGTTTTCT TATCTATTTG CACTAGTAGT TTCTGACCTT TTCCCCTACT GTGATATTGT CGCCACACTC GTAACTAACC
TTTCCAGGAA GCAAGGCTTT CAGATCTGTG GTCAAAGTAT AAATTCATTT GTTCTTGCGA GCTTTGTACT GCACTACCAA
AACCATATGT GGATCTTATT CTGAATGTAA GATTCAAACT CTGAAGAAAA TACTGTCAGT AATTCGCCAT GCACTTTATT
TCACAAATTT AAGTTTATCA TTACAAGTTT ATTCACCTGC CAATATCGTA CAACGTTCTG AGAATTGTTA GGGACATTTC
ACTGCTTTGC TACTCTGTCT TTTGTACCAT CCTTTTGAAT TGAACTTATG CATTTCAACT TCTAGATAAA TCTCACCCAA
CATTAGTTGA ACTGTTGAAC GAATAAACCA CAAGTTCACA AGTCAATAAT ATCAACAATT TCTAGTCGAT TTTATGCATT
CATGCTAGCA AAATGTTTCT TGTCTTCTAA AAATTAATAA AAACAAGCTA ATACTTTCTT CATGCTGACA TGTCTGTGCT
GATCAGTGTG ATGCTAGGAA CTTGAAATCG CCACATAATG CTGTTACAGA CCCAGCAATT GAGGATTTGG ACAATAACTT
ACAACAGGCA ATATCTGAAT ACTCATTCCT TGATGACTCT AAAGCTTGCT GTGATGTAAT TGAAAGCATG CTTTCAGAAA
ACTTGATGAA TGATTTGCAG CAAGAGGAAC TTTCACCAAG GAAATACATA CTACACCCCC TACACCATAT CAGTGTCAGC
AGTTTCATGA TACTTGCCTC TGCATACCGG TGCAGTGCCT TCAAATCAAG CACTGATAAT TTGCATGGAG AAAATTGTGA
TTTCATTTTC AGAATGACCA AAGCTGCAGC AGCTTATTCA ATAGTTCTTG CAGGGGCTAC ACATCACTTG TTTTTATCTG
AATGTTCCTT TGTGACCCTT CTGTCGCATT TTTTGCTAAG CACTGGACAG TCCATATTAG ATTTTGCTGA ATGTATTAAG
GGAGAAACAA GGAAAAACAT GCCTGAAGCT ATCTTCAGCT TTGCTTCATG TTCAACAAAT TCGGCAAAAC ATGATTCTGT
GCGGTACAAT CAATTCAGAT CAACTTGTGA GAAGTTTGGC AAGCCCTTGT TATCTTTATC GTTGCAGTGC TGGCCATTTT
TAGCCCAAGG CTTACCCTGC CTGGAAAAGA TAAAGAACCC CATAGATTTC AGTTGGCTTG GTCCAGCAAT ATTTCAGGCT
TTCCAGCTTT CTGAGGAAGA TTCTTTCAAC CTTTCTGGTA AACATGCGCC AGCAACTCTC ATCGAGCAAC AGAAAGAGTG
CATTCTGAGC TTAGCTGTTT GCTGCATCAC CTACAGCAAA TACCTTGCAA GTATATGCTA TGGTCCAGAA CATTATTTGG
CAAATCGTGC TAAAGATCTG CTTGAATGTA TCAATCATGT ACAATGATCT CTCTGTGATA TATCTCTGGA GCTGATGTTT
GATGTGCTCT ATTGTCTTTA TCAAGGTGAG CAGCTTACTT TTAAGATTGT TGTAGGACTG AACTGATAGT TTCTTTTACA
AGCAGAACTT ATCAGCAATT TTTGTCAAGG GGGAGTTACA TGGATGCTAT TAACGTTTTC TGTTTTATTG TGATTAACAA
AGCTACTATA GATTAACAGT GACAAAATCA GTTTGTGGG

Locus: Os04g0423600

Loading...

Locus: Os04g0423600

Loading...