Os04t0429100-01

Locus

Os04g0429100

Description

Histone H3 lysine 36-specific methyltransferase, Control of flowering time

RAP-DB Gene Symbol Synonym(s)

OsSET19, SDG708

RAP-DB Gene Name Synonym(s)

SET protein 19, SET DOMAIN GROUP 708

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET19, SDG708

Oryzabase Gene Name Synonym(s)

SET protein 19

Transcript Evidence

AK073414

Protein Evidence

B9FF78

Literature

PMID: 26639303

PMID: 23762371

Note

  • Exon-intron structures and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

February 12, 2016

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: histone-lysine N-methyltransferase activity (GO:0018024)

Cellular Component: nucleus (GO:0005634)

Functional domain (InterPro)

AWS domain (IPR006560)

SET domain (IPR001214)

Post-SET domain (IPR003616)

Full-length cDNA

J033039I24 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0429100-01)

Others

Oryzabase (13384)

Transcript

2018 bp

>Os04t0429100-01 Histone H3 lysine 36-specific methyltransferase, Control of flowering time
AGCCGAATCCGTCTTTCCTCTCCTCCTCCTCCTCCTCCTCCGACCACCGGCCAGCCGGCG
AAGTCCTCCGCCGCGGAGCTCACCTCCTCCGGCGCCGGCGACGCCCCCCTCGGTAGCCCC
GGGGAGGACGCCTTTCCTCCGGCGACCACTTCCCCAGTCGCCGCCTCCGCCGCTCCTCGA
ACCACTCACGCGCCGCGCGGGCTCCTGTCCCAGGCTATCAGCCGCGATTTCCCTACCCCT
CTCGCCGGATACCTCGCCGCCGTCCAAGAGCTAGCGTCTCTGATGGAGGAAGAGCGCATG
GAGCCGCCGCCGCCGCCGCCGTACATCCACATCGAGACCAACGATTTCTTGCACAGGAGG
CACAAGAGGCAGAAAGAGGAGGACATAGCTGTGTGTGAGTGCCAGTATAATCTGCTGGAT
CCGGACAGCGCGTGCGGGGATCGGTGCTTGAACGTCTTGACTAGCACGGAGTGTACGCCT
GGATACTGCCTCTGCGGTGTATACTGCAAGAACCAGCGATTTCAAAAAAGCCAATATGCT
GCGACAAGGCTGGTAAAAACTGAAGGGCGTGGATGGGGCCTTTTGGCTGATGAGAATATT
ATGGCTGGACAATTTGTTATGGAATATTGTGGAGAAGTAATATCATGGAAGGAAGCCAAG
AGGAGATCTCAAGCATATGAAAACCAGGGTTTAACGGATGCCTATATTATCTATCTGAAT
GCTGATGAGTCTATCGACGCAACAAAGAAGGGGAGCCTGGCAAGATTCATCAACCATTCG
TGCCAACCAAACTGTGAGACAAGGAAATGGAATGTTCTTGGGGAAGTAAGAGTGGGAATT
TTTGCGAAACAAGATATTCCAATCGGAACGGAACTATCCTATGACTACAACTTTGAGTGG
TTTGGTGGTGCAATGGTGAGGTGCCTTTGTGGAGCTGGCAGCTGTTCTGGATTTCTTGGG
GCTAAATCACGTGGTTTCCAGGAGGCTACATACCTGTGGGAAGATGATGATGACAGGTTT
TCTGTTGAGAATGTTCCCCTTTATGATTCTGCTGATGATGAACCTACCAGCATTCCAAAG
GACATCTTAATAAAAGATGAGCCAAATACACAGGATGGCAACAACAACACAATCCAAAAT
ACTGGGATTCCTATTATTGCAAGTTCAAGTGAATTCACACCGATGAATGTTGAACCATCG
ATTGCGAGTTCAAATGAGTTCACACCGATGAATGTTGAACCATTGAATGTGAGCTCAAAT
GAATTGACACCAATGACTATTGAACCATTGAATGCTATTCCAATGGGAGTTGATTTTACT
CAGAATGGATCAATTGAATATGGTGCGCAATGTGCTGAAGATGCTCTGCAAAACTCAACG
CGTGGAGTTGCAAACCTCCAGAATCAAAGTGCGCCCCGGGACAACAACCATACAGAGTTG
GTTGCGGTGAAACGTAGACCCACACTTCGTGGTGGAAAAGCTAAACGTGGTATGCGCAAG
CAACTGAATGTTGTGGGTATCTGTGATCGGTTAGCATCAGAGGTGGCACGTGAAGAAATA
TTGTATTGCGAGGAAATGAAGAATGAAGCTGCTGCTGAAATTGACAGCCTGTACGACGAG
ATAAGGCCGGCGATCGAAGAGCATGAGAGGGATAGTCAAGACAGCGTGGCCACAAGCCTT
GCAGAGAAGTGGATTGAGGCTAGCTGCTGCAAGTACAAAGCTGATTTTGATCTGTATGCT
TCCATTATCAAGAATCTTGCTTCCACACCTCTAAGATCAAAAGAAGACGCGGCCCCTACA
GAGCAAAATGGATTGATGTACTTGGAAAACGGTCCATGAACCGATTTACAAATTGGACTT
GTAAAAGCTAGAAAAAGGCTAGAGATTGATTGTCAGACATAGTTGAGGTTTAGGGGATTA
TCTTCCCTGATACAATTTGGTTAAGAAAATTATGCAAGGTCATATTTTTCTTATTGCAAA
TACCATTAACGTGAGTATGTTTACTCATGGAAACCCTG

CDS

1557 bp

>Os04t0429100-01 Histone H3 lysine 36-specific methyltransferase, Control of flowering time
ATGGAGGAAGAGCGCATGGAGCCGCCGCCGCCGCCGCCGTACATCCACATCGAGACCAAC
GATTTCTTGCACAGGAGGCACAAGAGGCAGAAAGAGGAGGACATAGCTGTGTGTGAGTGC
CAGTATAATCTGCTGGATCCGGACAGCGCGTGCGGGGATCGGTGCTTGAACGTCTTGACT
AGCACGGAGTGTACGCCTGGATACTGCCTCTGCGGTGTATACTGCAAGAACCAGCGATTT
CAAAAAAGCCAATATGCTGCGACAAGGCTGGTAAAAACTGAAGGGCGTGGATGGGGCCTT
TTGGCTGATGAGAATATTATGGCTGGACAATTTGTTATGGAATATTGTGGAGAAGTAATA
TCATGGAAGGAAGCCAAGAGGAGATCTCAAGCATATGAAAACCAGGGTTTAACGGATGCC
TATATTATCTATCTGAATGCTGATGAGTCTATCGACGCAACAAAGAAGGGGAGCCTGGCA
AGATTCATCAACCATTCGTGCCAACCAAACTGTGAGACAAGGAAATGGAATGTTCTTGGG
GAAGTAAGAGTGGGAATTTTTGCGAAACAAGATATTCCAATCGGAACGGAACTATCCTAT
GACTACAACTTTGAGTGGTTTGGTGGTGCAATGGTGAGGTGCCTTTGTGGAGCTGGCAGC
TGTTCTGGATTTCTTGGGGCTAAATCACGTGGTTTCCAGGAGGCTACATACCTGTGGGAA
GATGATGATGACAGGTTTTCTGTTGAGAATGTTCCCCTTTATGATTCTGCTGATGATGAA
CCTACCAGCATTCCAAAGGACATCTTAATAAAAGATGAGCCAAATACACAGGATGGCAAC
AACAACACAATCCAAAATACTGGGATTCCTATTATTGCAAGTTCAAGTGAATTCACACCG
ATGAATGTTGAACCATCGATTGCGAGTTCAAATGAGTTCACACCGATGAATGTTGAACCA
TTGAATGTGAGCTCAAATGAATTGACACCAATGACTATTGAACCATTGAATGCTATTCCA
ATGGGAGTTGATTTTACTCAGAATGGATCAATTGAATATGGTGCGCAATGTGCTGAAGAT
GCTCTGCAAAACTCAACGCGTGGAGTTGCAAACCTCCAGAATCAAAGTGCGCCCCGGGAC
AACAACCATACAGAGTTGGTTGCGGTGAAACGTAGACCCACACTTCGTGGTGGAAAAGCT
AAACGTGGTATGCGCAAGCAACTGAATGTTGTGGGTATCTGTGATCGGTTAGCATCAGAG
GTGGCACGTGAAGAAATATTGTATTGCGAGGAAATGAAGAATGAAGCTGCTGCTGAAATT
GACAGCCTGTACGACGAGATAAGGCCGGCGATCGAAGAGCATGAGAGGGATAGTCAAGAC
AGCGTGGCCACAAGCCTTGCAGAGAAGTGGATTGAGGCTAGCTGCTGCAAGTACAAAGCT
GATTTTGATCTGTATGCTTCCATTATCAAGAATCTTGCTTCCACACCTCTAAGATCAAAA
GAAGACGCGGCCCCTACAGAGCAAAATGGATTGATGTACTTGGAAAACGGTCCATGA

Protein

519 aa

>Os04t0429100-01 Histone H3 lysine 36-specific methyltransferase, Control of flowering time
MEEERMEPPPPPPYIHIETNDFLHRRHKRQKEEDIAVCECQYNLLDPDSACGDRCLNVLT
STECTPGYCLCGVYCKNQRFQKSQYAATRLVKTEGRGWGLLADENIMAGQFVMEYCGEVI
SWKEAKRRSQAYENQGLTDAYIIYLNADESIDATKKGSLARFINHSCQPNCETRKWNVLG
EVRVGIFAKQDIPIGTELSYDYNFEWFGGAMVRCLCGAGSCSGFLGAKSRGFQEATYLWE
DDDDRFSVENVPLYDSADDEPTSIPKDILIKDEPNTQDGNNNTIQNTGIPIIASSSEFTP
MNVEPSIASSNEFTPMNVEPLNVSSNELTPMTIEPLNAIPMGVDFTQNGSIEYGAQCAED
ALQNSTRGVANLQNQSAPRDNNHTELVAVKRRPTLRGGKAKRGMRKQLNVVGICDRLASE
VAREEILYCEEMKNEAAAEIDSLYDEIRPAIEEHERDSQDSVATSLAEKWIEASCCKYKA
DFDLYASIIKNLASTPLRSKEDAAPTEQNGLMYLENGP*

5'UTR

chr04:21258050..21258331 (+ strand) : 282 bp

CDS

chr04:21258332..21258334 (+ strand) : 3 bp

chr04:21258420..21258493 (+ strand) : 74 bp

chr04:21258585..21258741 (+ strand) : 157 bp

chr04:21259200..21259286 (+ strand) : 87 bp

chr04:21259385..21259469 (+ strand) : 85 bp

chr04:21260456..21260549 (+ strand) : 94 bp

chr04:21260687..21260885 (+ strand) : 199 bp

chr04:21261161..21261195 (+ strand) : 35 bp

chr04:21261721..21262276 (+ strand) : 556 bp

chr04:21262367..21262633 (+ strand) : 267 bp

3'UTR

chr04:21262634..21262812 (+ strand) : 179 bp

FASTA

>Os04t0429100-01 class=Sequence position=chr04:21258050..21262812 (+ strand)
AGCCGAATCC GTCTTTCCTC TCCTCCTCCT CCTCCTCCTC CGACCACCGG CCAGCCGGCG AAGTCCTCCG CCGCGGAGCT
CACCTCCTCC GGCGCCGGCG ACGCCCCCCT CGGTAGCCCC GGGGAGGACG CCTTTCCTCC GGCGACCACT TCCCCAGTCG
CCGCCTCCGC CGCTCCTCGA ACCACTCACG CGCCGCGCGG GCTCCTGTCC CAGGCTATCA GCCGCGATTT CCCTACCCCT
CTCGCCGGAT ACCTCGCCGC CGTCCAAGAG CTAGCGTCTC TGATGGTAAC TTCTCTGTGA GCTCGCTCGC TCGCTCGTAG
AGATTCCTGA TTCTGTATGA TTGAGCTCCC CGGGCTGTTC GGTTTTGCAG GAGGAAGAGC GCATGGAGCC GCCGCCGCCG
CCGCCGTACA TCCACATCGA GACCAACGAT TTCTTGCACA GGAGGTGAGT GAGTTTCACG GCGATGTGGG ACAACGGCTG
CGTCCTGTGC TTTTGGATGT AATGCGAATC TTTATACTTT GGTGCGCGAT GCTAGGCACA AGAGGCAGAA AGAGGAGGAC
ATAGCTGTGT GTGAGTGCCA GTATAATCTG CTGGATCCGG ACAGCGCGTG CGGGGATCGG TGCTTGAACG TCTTGACTAG
CACGGAGTGT ACGCCTGGAT ACTGCCTCTG CGGTGTATAC TGCAAGAACC AGGTTGGTGT TTCTCTTGTT CAAGTAGTAG
CGCAACCGTT CCAAATCTTG ATTGAATGAA TATCCATACA TTTGTTCTTA CATGATTACT TTAGTTCACT CGAGCCTAGT
TACTAGGCAG GAGGGGAAAA AAATGGTGTA ACACGGTTAT TTTGCTTTCT TGTCTTCTTG ATTGAATATA ATCCAGTTTA
TTATAgatgt acagcaattt tcaatatagt cgtgctggct cttagctgta aggatttttt ttcaagtgag attgaatata
atctggtttc ttatacatga tgtaccatta tttctaatat atagttttac taattttcta tagatACCGA ACACTATCAT
TTTCAATATA TAGTTTTACC AATTTGCTAG GGAGGCCGAA TGTCATCTGG AGTGCTTTAC AGTTTCACTG GTAGTTATGT
TTGTATTTTA ATCAATTTCT CTGTTGGCAG CGATTTCAAA AAAGCCAATA TGCTGCGACA AGGCTGGTAA AAACTGAAGG
GCGTGGATGG GGCCTTTTGG CTGATGAGAA TATTATGGTG ACTGAATTTA CCTTGATTTT ATGGTCTGCT AATGTTGTTA
AATATATTCA AGTGAGTATG CTTTAGTGAG TCATTGTTTT CTTAATGGTT TTTAGGCTGG ACAATTTGTT ATGGAATATT
GTGGAGAAGT AATATCATGG AAGGAAGCCA AGAGGAGATC TCAAGCATAT GAAAACCAGG GTCTGTTGAT TTTATCTTCC
CTCAATGTTA GCATGGTGGT ACATTTTGGC tagggatggc aaccgggcca tccccggcgg ggtgtggtcc cccgtccccg
tccccgtccc cgtgcagtta gaaatcaccc gcccccgtcc ccggtgtcgg ggctgtattt ctcccgtccc caagcctcgc
cgggtgcacg gggcacccac ggggTCGCAC ACCCGATAAA CTCGTGGGCA TAAATCAACA AGAAGGTTCT CTAGTAGGAA
GGTAGAAGTA GAACAGATCG GCAAAAATAG CACGAGGACA TACATCTATC ATTTTCTCAG ATTATGAACA TGACCATGGT
GCCAGACTTG CATGATTCTG TTGCCAAGAA TCAGCTCCAA CTTCCATCAA AATGAGAAAA ATAAACAGCG ACAAACAGGA
CAGAGCAGAA AATAACAAGC AAAGTATATA CCGGCATTCG GATGCAGCAA GTGCCCGTCC TCTTGCTTTC CCGCATGAGC
AAGCGACTTG GAGGCAGAAC AACAGCTCGC GCGGCATGGT CACCTTATGC GGCGGCGGGG TGCTATATCG CTGCTGTGGC
CTGGAGGAGG TGCGATGGCT GGCGCCCTTG CCGACCTCGA CTGGCGGCTG CTGATGGATC TGAGAAGGGG ACAAGGGAGG
ACTGGTCTAG TGTAGGGTTT CTTTTGCTTT ATATACCAGC ACCTCTAAAT TGGGCACTAA GTGGGCTTTT AACTTTTATG
GACTGTACAT ATGCCTACAC TACTCGAGTC acccacgggg attcggggcc gggtgcctat ggaacatccc cgtccccgca
tcacccaacg gtgacagttt ctagccgata acagccccat gggtgatgaa tttagcctgt ttacataccc taatagagtt
tttacctatc gggtatcggg gttcgggtcc ccattgccat ccctaATTTT GGCTAGCTAT AACATTTGTT TTTTGTGCCC
TGTTAGGTTT AACGGATGCC TATATTATCT ATCTGAATGC TGATGAGTCT ATCGACGCAA CAAAGAAGGG GAGCCTGGCA
AGATTCATCA ACCATTCGTG GTATGTCTTG TAGCAAATAT ATGTCTGCCT ATATTATGTT TCTTTCATAT GCATTATTTG
ATAATTGATT ATCGAGTTTT TTTCCATTTA CTAGCATTTA ATGATTAAAT CTGATAGCTT GTTATTGAAG CATGCAGCCA
ACCAAACTGT GAGACAAGGA AATGGAATGT TCTTGGGGAA GTAAGAGTGG GAATTTTTGC GAAACAAGAT ATTCCAATCG
GAACGGAACT ATCCTATGAC TACAACTTTG AGTGGTTTGG TGGTGCAATG GTGAGGTGCC TTTGTGGAGC TGGCAGCTGT
TCTGGATTTC TTGGGGCTAA ATCACGTGGT TTCCAGGTAA AAAGTTGTTG TGTGATATGT CTTGTAACCT GAAAAGCACC
ATTTTATAAG TAGGATTTTC CCTTGCACAT GTGCTGGCAT AATTCTTCTG CATTTCTCTC TTACCATGAG TGCTGAAGTA
CAGGTTACAT GCACAGTCGC TTCATAAATT GTTAATTTAT ATAGGAGTAG TTACAAATTG GTTACATTTT CAGTGTTTAT
TTTCATTTTT ACATTCCTTT TAGAATGCCC ATCGCTTATG TAATGAATGC TACATTTTTG CCATGTTTTA GGAGGCTACA
TACCTGTGGG AAGATGATGA TGACAGGTAG GATTGTGCTT GTACTTACCT ATCCAATCTG CTGAATAAAA TATTGTCTAT
TCAAATGGTC CCAGGAAGTT ATATGTGGTA ACTTCTGTAA TTGGATGGTT TTACTTAGCA GTGACCTTTC TCTGTtattc
cctcagtccc aaaatataat aacttaggat cagatgggac gtttcctagt actacaaatc tggacaggaa acgtcccatc
cgatcctagg ttgttatatt ttaggacgga gggagtaGTT AAGACAAATA GGAAAAAAGA AGCAATTAAA CAGCATGTTA
ACATAACTAC TATTATGTCT TGCTTTATTA TCTTCTCAGA TCCATATTAC TGTCATGTCT TGCATTATCA TCATAGAAGA
AGATCCTAGT TGGTTAAAAA TATGCAGATT TGTGTTGCCT GGGTCAACCT GTCATTTCAA ACAAAGCCTG AATTTCTTGA
AATGCCGAAA TATCGACGGA TACAACAAAT CTGAGCACCG GTTAACATAT GCTTTCCATC TTAAATTGCA GGTTTTCTGT
TGAGAATGTT CCCCTTTATG ATTCTGCTGA TGATGAACCT ACCAGCATTC CAAAGGACAT CTTAATAAAA GATGAGCCAA
ATACACAGGA TGGCAACAAC AACACAATCC AAAATACTGG GATTCCTATT ATTGCAAGTT CAAGTGAATT CACACCGATG
AATGTTGAAC CATCGATTGC GAGTTCAAAT GAGTTCACAC CGATGAATGT TGAACCATTG AATGTGAGCT CAAATGAATT
GACACCAATG ACTATTGAAC CATTGAATGC TATTCCAATG GGAGTTGATT TTACTCAGAA TGGATCAATT GAATATGGTG
CGCAATGTGC TGAAGATGCT CTGCAAAACT CAACGCGTGG AGTTGCAAAC CTCCAGAATC AAAGTGCGCC CCGGGACAAC
AACCATACAG AGTTGGTTGC GGTGAAACGT AGACCCACAC TTCGTGGTGG AAAAGCTAAA CGTGGTATGC GCAAGCAACT
GAATGTTGTG GGTATCTGTG ATCGGTTAGC ATCAGAGGTG GCACGTGAAG AAATATTGTA TTGCGAGGTA AAGAACTACT
GTAACTCCCT TTTTATTGAA CATTGCTCTA GGAAAGCTTA GGCTTTGCAA TGACCTTTTT TCCAAATCAA ATGTCAGGAA
ATGAAGAATG AAGCTGCTGC TGAAATTGAC AGCCTGTACG ACGAGATAAG GCCGGCGATC GAAGAGCATG AGAGGGATAG
TCAAGACAGC GTGGCCACAA GCCTTGCAGA GAAGTGGATT GAGGCTAGCT GCTGCAAGTA CAAAGCTGAT TTTGATCTGT
ATGCTTCCAT TATCAAGAAT CTTGCTTCCA CACCTCTAAG ATCAAAAGAA GACGCGGCCC CTACAGAGCA AAATGGATTG
ATGTACTTGG AAAACGGTCC ATGAACCGAT TTACAAATTG GACTTGTAAA AGCTAGAAAA AGGCTAGAGA TTGATTGTCA
GACATAGTTG AGGTTTAGGG GATTATCTTC CCTGATACAA TTTGGTTAAG AAAATTATGC AAGGTCATAT TTTTCTTATT
GCAAATACCA TTAACGTGAG TATGTTTACT CATGGAAACC CTG

Locus: Os04g0429100

Loading...

Locus: Os04g0429100

Loading...