Os04t0431700-01

Locus

Os04g0431700

Description

Exocyst-localized protein, Resistance to planthoppers, (Nipponbare: BPH-susceptible)

RAP-DB Gene Symbol Synonym(s)

Bph6

RAP-DB Gene Name Synonym(s)

brown planthopper resistance 6

CGSNL Gene Symbol

BPH6

CGSNL Gene Name

BROWN PLANTHOPPER RESISTANCE 6

Oryzabase Gene Symbol Synonym(s)

Bph6

Oryzabase Gene Name Synonym(s)

brown planthopper resistance 6, Brown planthopper resistance-6

Transcript Evidence

AK243005

Protein Evidence

A0A0P0WAN7

Literature

PMID: 29358653

Note

Manual Curation

February 22, 2018

Functional domain (InterPro)

Leucine-rich repeat domain superfamily (IPR032675)

Experimentally confirmed subcellular location

exocyst (GO:0000145)

Full-length cDNA

J090096I12 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0431700-01)

Others

Oryzabase (39)

KEGG (Os04t0431700-01)

Transcript

3726 bp

>Os04t0431700-01 Exocyst-localized protein, Resistance to planthoppers, (Nipponbare: BPH-susceptible)
GTGCTCGCGCTCGCGCAGAAGCCCATCTATCCAAGCATTCCAATTGCTGCTGCTTCCATC
GGTCGGCCAGAATTGCTGCATGCTGTTGTCTTAAGTTATTTGGAGCATTCTTCAGTTCGT
CCATCTAGCCTGACTTCATACTTGCTTCACCTGGCTCAGGGCCTCTGGCGCTCTGCTCTA
TATATATACTCAGGTGGCGAGTGGAATTGATCGGTTGATACAATCTGATACGATGGGTTA
GATTAATTGATTTTCTGACGATTCTCCTCTTCCTGATCACCATGATTAAAGCTAATGTAA
ATTGGGATACTTTTGATTGGGCTGTGCAAGGGATACTTGAACATTTTGTTAAAAATCAGA
GGGACACAAGAGTTATATATTTTGATGGCTGGCGTGGTTTTGGAGCATCAGCAGTCCTTA
GAGCTGTAGCAGATGAGCTTACATCTCGAGGAGCTTGGCCAGAACTACACATTGATAAAG
TAATCCAGATTGACTGCTCTACATGGAAAAGTAGAAGGGCAATGCAGAGGGCAATTGCAG
TGGAACTCAAGCTTGATGATTCGGTAATTGAAATTATTGATAAGACAGATGAGGAGGATG
ATTTTAAGGGAGTGGATGAAGGCTCTAGAAGCGAGATAATGAGTGTTGCAGAAGTGATTG
ATCAAGTCCTCAGGGATCACAAATTTATGGTTGCTTTTCATAATGGAAGTGGTGATTACA
TTGATTTAGGTAGCTTTGGGTTCCCGCAAATTACACTATTTCGTTCCAATCTAATATTAT
GGACCTTTCGGAAGAGGTTCCAAGGAAGGGAGCGTTACTCTGAGATAAAAGACAAAGTGA
AGAACACCCATTTATTCGCATTTGAAACAGAGTATTATATAACAAGAAACAACATTCTCT
TCCCAGTACTGCAAAAAGAGGCTGCTGCCATAGCTGCCCATTATCCTTGCATGCGGGAGA
TCGACCCGGAAAGGATCGTGCATTGCTGTCTATATGGACTATTTCTCTATCTTTGTTTGC
CCAAACATTTGGAGAATGAGTGGGCAGCCCGAGCATCAGTGTACTGGATGTGTGATGGCA
TCATACAAGGTGATCAGGCATGGGAGATAAGCGCTGCACTTTCAAAAGAAATAAAGTGGG
ATCTACAACCTTCTTTACAAGATGAGGTGCGTCAAGAATTCATAGAATCATCCTCAAAAA
ACTCTGTAAGTATCCAGAGATTCAAAAACAGATACTTTGATGGGCAAAAGTTTTACCCTT
GGATCACAATCACTGCATCAAATAATATTAATCCAGAAACACTACAGGACATCCGATCCA
AAAATGCAGAGGCATCGTCTTATTTCTTGGCTCCTGAAAGATCCAGTGATATCACACTAG
TGTTATCTGATGGGTTGTTTGACCAATGGAACAACCTCCAAGTTCTGCAGTTGTCATATT
GTGACTTCAGCTTTGCATCACCACCTTTTATTGGTTGCCAGAATCTAAGATTTATTGGGC
TTGACCACTGTAAAGATAAAAAAGAAGGATGCAAACAAAGTGACCTAAGGAAGTGGCAGT
TTCTCCATAGCTTATTAGTTTTGGATCTCATTGACACTATCTGGTACCAAGTATTTTCCG
AAGACATGGCAGATCTTTTTGTTAACCTTAGGGAGCTAAATATAGTAGGAGTTTATTGCT
CTCACATATGGGGCCAGCTACAAAATAAGATTGAATATGTTGATTTGTCTAGGAAAAGGA
ATATAAAACTTCCTTCCACTCTAAGATTCTTCAGGCTTGATGACCGTCAACCTACACCGC
AGTCCACACCGGGCATTGAATTATCGCTAAAAGGTTGCATGGGATTGGAAAGTTTATTCC
TGAGTCGAATATCCAACCTCACGGAGCTGGACCTCTCCGGAACTGCAATCAGGATACTTG
ACTTCACAGCTATGGTGGTGGAAGTCTCAGGTTTGAAACGACTATTTCTGCTAGGATGCA
AGCAACTCCAAGCAATAAAATGGGACAATAGTGGTTCAACGATAAAGCCGGACCTAGAGT
TGTTGTGCGTTGACACAAGGTCTAGAAGTAAATATCCTCAGTTATTTGTTGACAAGAATA
AATCCCCCGGTTTCTTGTCAGTCCATGCTGTTATTGTGGACGCGAGAATTGCTCGGTCCT
TATGCGCTCTAATAGAGAACTCATATCATGTTGATATGCATATCCATGTCACCTCTTCGA
CCATATATGGTGAAGTTCAATCCGAAGGAACCTACAAAGATAGCATTAGCCAATTAAGTG
ATCATGTGAACATGCAGCAACAAGACCTTATTTCAGCAGGCCAGTACCATGATGTCCAAC
TTAGCATGGTTGGCGATGTCCCAATGCAGTCATTCCCCCTTCCTCCGACAACAATGTTGA
GCCGCCATATCGAGATTGCACAGGGGAGCCACAACCTGGAGAGCGAGCTGGATGATGATT
CACCGATTCTTACTTTAGCTCATCTAGTGCAGGGGAAGGCTGAGTCACTGCATGTGCATG
ATCTCTCAACCATCACTCCTTTGCCCGGAGGACAATGGTGCTGTCTCAAGTGGTGTCGTA
TAGAGAGGTGCCCGAAGATAGAAATTGTCTTCCCTAAACACGCATGGAATTTCTACGGTC
TGGAAACCGCCTGGGTGTCGGATCTCTTGATGGCCCGTTGCATCTGGAGTAAAGGTTCTC
TCCAGTACAGTGGTTCCTTCCAAAATCTGCAGCACCTGCACCTGCGCAGCTGCCCAAGGC
TCCAGTTCGTGCTCCCGGTGTGGGCCTCCTCCTTCCCGGACCTGAAAACCCTCCACGTCA
TCCACTGCAGCAACCTCCACAACATCTTCGTGCTGGACGGAGATTACCCAGAGCAAATAA
CCGTCGAAGGTGTAGCATTCCCGAAGCTAACCACCATCCACCTGCACGACCTCCCGATGC
TGCGGCAGATTTGCGACGTCGAGTTCAAGATGGTGGCTCCCGCGCTCGAGACCATCAAGA
TCAGGGGATGCTGGGGCCTGCGCCGGCTGCCGGCCGTCGCTGCGGATGGACCGAAGCCGG
CCGTGGAGATCGAGAAGGACGTGTGGGACGCGCTGGAGTGGGACGGGGTGGAAGCCGACC
ACCACCCTTCCCTCTTCCAGGCGCCGGTGCACTCGCGCTACTACAGGAAGAAGCTGCCCA
GGGGCTCCGTCCTCAGGTGAATTGAATCCCTGGGCTTGGGCGGCCATGATTTGGGGATTG
ATTGGCGACGAATGATGGTGAATCAGTGAGATGCTTCTTGCTTGCTTCTGTTGGGTGATT
TGTCTCCGGTGATGTTGCAGCAAGCTTTGTGGTGTGAGCTGTGTGACGGGCACGGACTGA
CCGTGGCTCGATCTTGTCCTCGTATATGGCCGAGTTGGCCAGAGAGCGAGATTGCCATGG
CTCTGAAATAATAAGCGGCTTTGTTTGTGCGTGGATGCACAGACCAGCTGATTGAGTGAG
TGTGTGTTTCTTGAATTTAATTAGCATTCTGGGTGTGGATGCTCAGATGCATGTGTGTGT
GTGGCTTGATATGATGATCTGCTTTGCGTTTGAAACAATAATAAGCAGTAGCCATTTGTG
CCTGCGAGCATATGTATGTGGCTGCTGCAGTGTGACTGTGTGAGAGTGCATTGCTTGTGT
GTAACTGAATTCTGAAGATTCTGAACAGATGAGCAGCTGGTTGTGTGTGCTTGCTTGCAT
GCATGC

CDS

2919 bp

>Os04t0431700-01 Exocyst-localized protein, Resistance to planthoppers, (Nipponbare: BPH-susceptible)
ATGATTAAAGCTAATGTAAATTGGGATACTTTTGATTGGGCTGTGCAAGGGATACTTGAA
CATTTTGTTAAAAATCAGAGGGACACAAGAGTTATATATTTTGATGGCTGGCGTGGTTTT
GGAGCATCAGCAGTCCTTAGAGCTGTAGCAGATGAGCTTACATCTCGAGGAGCTTGGCCA
GAACTACACATTGATAAAGTAATCCAGATTGACTGCTCTACATGGAAAAGTAGAAGGGCA
ATGCAGAGGGCAATTGCAGTGGAACTCAAGCTTGATGATTCGGTAATTGAAATTATTGAT
AAGACAGATGAGGAGGATGATTTTAAGGGAGTGGATGAAGGCTCTAGAAGCGAGATAATG
AGTGTTGCAGAAGTGATTGATCAAGTCCTCAGGGATCACAAATTTATGGTTGCTTTTCAT
AATGGAAGTGGTGATTACATTGATTTAGGTAGCTTTGGGTTCCCGCAAATTACACTATTT
CGTTCCAATCTAATATTATGGACCTTTCGGAAGAGGTTCCAAGGAAGGGAGCGTTACTCT
GAGATAAAAGACAAAGTGAAGAACACCCATTTATTCGCATTTGAAACAGAGTATTATATA
ACAAGAAACAACATTCTCTTCCCAGTACTGCAAAAAGAGGCTGCTGCCATAGCTGCCCAT
TATCCTTGCATGCGGGAGATCGACCCGGAAAGGATCGTGCATTGCTGTCTATATGGACTA
TTTCTCTATCTTTGTTTGCCCAAACATTTGGAGAATGAGTGGGCAGCCCGAGCATCAGTG
TACTGGATGTGTGATGGCATCATACAAGGTGATCAGGCATGGGAGATAAGCGCTGCACTT
TCAAAAGAAATAAAGTGGGATCTACAACCTTCTTTACAAGATGAGGTGCGTCAAGAATTC
ATAGAATCATCCTCAAAAAACTCTGTAAGTATCCAGAGATTCAAAAACAGATACTTTGAT
GGGCAAAAGTTTTACCCTTGGATCACAATCACTGCATCAAATAATATTAATCCAGAAACA
CTACAGGACATCCGATCCAAAAATGCAGAGGCATCGTCTTATTTCTTGGCTCCTGAAAGA
TCCAGTGATATCACACTAGTGTTATCTGATGGGTTGTTTGACCAATGGAACAACCTCCAA
GTTCTGCAGTTGTCATATTGTGACTTCAGCTTTGCATCACCACCTTTTATTGGTTGCCAG
AATCTAAGATTTATTGGGCTTGACCACTGTAAAGATAAAAAAGAAGGATGCAAACAAAGT
GACCTAAGGAAGTGGCAGTTTCTCCATAGCTTATTAGTTTTGGATCTCATTGACACTATC
TGGTACCAAGTATTTTCCGAAGACATGGCAGATCTTTTTGTTAACCTTAGGGAGCTAAAT
ATAGTAGGAGTTTATTGCTCTCACATATGGGGCCAGCTACAAAATAAGATTGAATATGTT
GATTTGTCTAGGAAAAGGAATATAAAACTTCCTTCCACTCTAAGATTCTTCAGGCTTGAT
GACCGTCAACCTACACCGCAGTCCACACCGGGCATTGAATTATCGCTAAAAGGTTGCATG
GGATTGGAAAGTTTATTCCTGAGTCGAATATCCAACCTCACGGAGCTGGACCTCTCCGGA
ACTGCAATCAGGATACTTGACTTCACAGCTATGGTGGTGGAAGTCTCAGGTTTGAAACGA
CTATTTCTGCTAGGATGCAAGCAACTCCAAGCAATAAAATGGGACAATAGTGGTTCAACG
ATAAAGCCGGACCTAGAGTTGTTGTGCGTTGACACAAGGTCTAGAAGTAAATATCCTCAG
TTATTTGTTGACAAGAATAAATCCCCCGGTTTCTTGTCAGTCCATGCTGTTATTGTGGAC
GCGAGAATTGCTCGGTCCTTATGCGCTCTAATAGAGAACTCATATCATGTTGATATGCAT
ATCCATGTCACCTCTTCGACCATATATGGTGAAGTTCAATCCGAAGGAACCTACAAAGAT
AGCATTAGCCAATTAAGTGATCATGTGAACATGCAGCAACAAGACCTTATTTCAGCAGGC
CAGTACCATGATGTCCAACTTAGCATGGTTGGCGATGTCCCAATGCAGTCATTCCCCCTT
CCTCCGACAACAATGTTGAGCCGCCATATCGAGATTGCACAGGGGAGCCACAACCTGGAG
AGCGAGCTGGATGATGATTCACCGATTCTTACTTTAGCTCATCTAGTGCAGGGGAAGGCT
GAGTCACTGCATGTGCATGATCTCTCAACCATCACTCCTTTGCCCGGAGGACAATGGTGC
TGTCTCAAGTGGTGTCGTATAGAGAGGTGCCCGAAGATAGAAATTGTCTTCCCTAAACAC
GCATGGAATTTCTACGGTCTGGAAACCGCCTGGGTGTCGGATCTCTTGATGGCCCGTTGC
ATCTGGAGTAAAGGTTCTCTCCAGTACAGTGGTTCCTTCCAAAATCTGCAGCACCTGCAC
CTGCGCAGCTGCCCAAGGCTCCAGTTCGTGCTCCCGGTGTGGGCCTCCTCCTTCCCGGAC
CTGAAAACCCTCCACGTCATCCACTGCAGCAACCTCCACAACATCTTCGTGCTGGACGGA
GATTACCCAGAGCAAATAACCGTCGAAGGTGTAGCATTCCCGAAGCTAACCACCATCCAC
CTGCACGACCTCCCGATGCTGCGGCAGATTTGCGACGTCGAGTTCAAGATGGTGGCTCCC
GCGCTCGAGACCATCAAGATCAGGGGATGCTGGGGCCTGCGCCGGCTGCCGGCCGTCGCT
GCGGATGGACCGAAGCCGGCCGTGGAGATCGAGAAGGACGTGTGGGACGCGCTGGAGTGG
GACGGGGTGGAAGCCGACCACCACCCTTCCCTCTTCCAGGCGCCGGTGCACTCGCGCTAC
TACAGGAAGAAGCTGCCCAGGGGCTCCGTCCTCAGGTGA

Protein

973 aa

>Os04t0431700-01 Exocyst-localized protein, Resistance to planthoppers, (Nipponbare: BPH-susceptible)
MIKANVNWDTFDWAVQGILEHFVKNQRDTRVIYFDGWRGFGASAVLRAVADELTSRGAWP
ELHIDKVIQIDCSTWKSRRAMQRAIAVELKLDDSVIEIIDKTDEEDDFKGVDEGSRSEIM
SVAEVIDQVLRDHKFMVAFHNGSGDYIDLGSFGFPQITLFRSNLILWTFRKRFQGRERYS
EIKDKVKNTHLFAFETEYYITRNNILFPVLQKEAAAIAAHYPCMREIDPERIVHCCLYGL
FLYLCLPKHLENEWAARASVYWMCDGIIQGDQAWEISAALSKEIKWDLQPSLQDEVRQEF
IESSSKNSVSIQRFKNRYFDGQKFYPWITITASNNINPETLQDIRSKNAEASSYFLAPER
SSDITLVLSDGLFDQWNNLQVLQLSYCDFSFASPPFIGCQNLRFIGLDHCKDKKEGCKQS
DLRKWQFLHSLLVLDLIDTIWYQVFSEDMADLFVNLRELNIVGVYCSHIWGQLQNKIEYV
DLSRKRNIKLPSTLRFFRLDDRQPTPQSTPGIELSLKGCMGLESLFLSRISNLTELDLSG
TAIRILDFTAMVVEVSGLKRLFLLGCKQLQAIKWDNSGSTIKPDLELLCVDTRSRSKYPQ
LFVDKNKSPGFLSVHAVIVDARIARSLCALIENSYHVDMHIHVTSSTIYGEVQSEGTYKD
SISQLSDHVNMQQQDLISAGQYHDVQLSMVGDVPMQSFPLPPTTMLSRHIEIAQGSHNLE
SELDDDSPILTLAHLVQGKAESLHVHDLSTITPLPGGQWCCLKWCRIERCPKIEIVFPKH
AWNFYGLETAWVSDLLMARCIWSKGSLQYSGSFQNLQHLHLRSCPRLQFVLPVWASSFPD
LKTLHVIHCSNLHNIFVLDGDYPEQITVEGVAFPKLTTIHLHDLPMLRQICDVEFKMVAP
ALETIKIRGCWGLRRLPAVAADGPKPAVEIEKDVWDALEWDGVEADHHPSLFQAPVHSRY
YRKKLPRGSVLR*

5'UTR

chr04:21396879..21397071 (+ strand) : 193 bp

chr04:21397269..21397356 (+ strand) : 88 bp

CDS

chr04:21397357..21397368 (+ strand) : 12 bp

chr04:21398247..21401149 (+ strand) : 2903 bp

chr04:21401300..21401303 (+ strand) : 4 bp

3'UTR

chr04:21401304..21401829 (+ strand) : 526 bp

FASTA

>Os04t0431700-01 class=Sequence position=chr04:21396879..21401829 (+ strand)
GTGCTCGCGC TCGCGCAGAA GCCCATCTAT CCAAGCATTC CAATTGCTGC TGCTTCCATC GGTCGGCCAG AATTGCTGCA
TGCTGTTGTC TTAAGTTATT TGGAGCATTC TTCAGTTCGT CCATCTAGCC TGACTTCATA CTTGCTTCAC CTGGCTCAGG
GCCTCTGGCG CTCTGCTCTA TATATATACT CAGGTACGTA TTAGTAATAA CTAATTATAT TTCTTGTAAC AATGCATCAA
CTTAATTAAT TTGCGGCTCG CTCGATCAGT GTTACTTAGT TTATTTGTTC ATCGATCTTT GAAAAAAAGA AGAAGCAGTT
CTACTGATTA TATATCAAAA CATCAATTGA TTATATATGG TTGATGTAAT TGTTGTGTAT ATGTGTGTAG GTGGCGAGTG
GAATTGATCG GTTGATACAA TCTGATACGA TGGGTTAGAT TAATTGATTT TCTGACGATT CTCCTCTTCC TGATCACCAT
GATTAAAGCT GTACACCTTC TAATTGCACT TTCACATTCT CGAATTATAT AGCATGTCTA TTTCTGTGTT TATTTCCTTT
TATTTGATCA ATTGATTTGA GACGTTGATG GCTTAACGTG CGCACATAAC ATCAATATTA GTCGTCCATA TATATATATA
TTCGCGATTA TAATTAAGTA TATAAGTGCC GGAATATATC TTGGCTTGGG GAGGGGGCTT ATTAATTAGC GCCAAGGTGT
GAAATGGTTT AGCTAGCATA TTAAAACAAA ATAATATGCA TGCATGATGT TGTTTCAATG GCCTAAAGGA ACTGGCATGC
ATCGATGTTT GCCAATTTTT ATCTCTAGTA AAGAAAAGCA AAGTAGATCC CCACATGCTC AGAACTTGTT TATTATTTTT
ATTTGAACAG AACAAAATTC ACTAGCAGCT GGTGATAAAA ACCAGTTGAT TACATATGCA CTATACCTAT AGCATATGTA
TGTATGTGCA AGTTAACCAT GTATCATCGA CCTATCGAGC ACGCTGACGT TAACCAAGCA AGATGGTCCG TGAATAGAAA
AGCACAGACA CTTTATTCTC TTTTTCCTTC AAAAATAAAA TTCTTCAAAA ATGACACATA GTTTGTTAAA TTCGGACTCC
ACTAAGACCC CGAATGCCAG AAATATTTTT CCTACATCCG AAGGCATCAT GATTCTCCGG TAAATGATTT ACAAAAAAAC
TAGATGAGTG CATATCTCTC ATTAGCTTTG TTTTGTACCG TGTTAGCTAG TACGCCTGCT TCAGCAACTC CTGTTGAGTG
CAGGGGACAT TGTAGAGCAA GATAGTTGTT GGTGTCCTCT GTAATATAAA GTCAATCTTA CACAGTCTAA TTTCTATTAT
TATGGCAGAA TGTAAATTGG GATACTTTTG ATTGGGCTGT GCAAGGGATA CTTGAACATT TTGTTAAAAA TCAGAGGGAC
ACAAGAGTTA TATATTTTGA TGGCTGGCGT GGTTTTGGAG CATCAGCAGT CCTTAGAGCT GTAGCAGATG AGCTTACATC
TCGAGGAGCT TGGCCAGAAC TACACATTGA TAAAGTAATC CAGATTGACT GCTCTACATG GAAAAGTAGA AGGGCAATGC
AGAGGGCAAT TGCAGTGGAA CTCAAGCTTG ATGATTCGGT AATTGAAATT ATTGATAAGA CAGATGAGGA GGATGATTTT
AAGGGAGTGG ATGAAGGCTC TAGAAGCGAG ATAATGAGTG TTGCAGAAGT GATTGATCAA GTCCTCAGGG ATCACAAATT
TATGGTTGCT TTTCATAATG GAAGTGGTGA TTACATTGAT TTAGGTAGCT TTGGGTTCCC GCAAATTACA CTATTTCGTT
CCAATCTAAT ATTATGGACC TTTCGGAAGA GGTTCCAAGG AAGGGAGCGT TACTCTGAGA TAAAAGACAA AGTGAAGAAC
ACCCATTTAT TCGCATTTGA AACAGAGTAT TATATAACAA GAAACAACAT TCTCTTCCCA GTACTGCAAA AAGAGGCTGC
TGCCATAGCT GCCCATTATC CTTGCATGCG GGAGATCGAC CCGGAAAGGA TCGTGCATTG CTGTCTATAT GGACTATTTC
TCTATCTTTG TTTGCCCAAA CATTTGGAGA ATGAGTGGGC AGCCCGAGCA TCAGTGTACT GGATGTGTGA TGGCATCATA
CAAGGTGATC AGGCATGGGA GATAAGCGCT GCACTTTCAA AAGAAATAAA GTGGGATCTA CAACCTTCTT TACAAGATGA
GGTGCGTCAA GAATTCATAG AATCATCCTC AAAAAACTCT GTAAGTATCC AGAGATTCAA AAACAGATAC TTTGATGGGC
AAAAGTTTTA CCCTTGGATC ACAATCACTG CATCAAATAA TATTAATCCA GAAACACTAC AGGACATCCG ATCCAAAAAT
GCAGAGGCAT CGTCTTATTT CTTGGCTCCT GAAAGATCCA GTGATATCAC ACTAGTGTTA TCTGATGGGT TGTTTGACCA
ATGGAACAAC CTCCAAGTTC TGCAGTTGTC ATATTGTGAC TTCAGCTTTG CATCACCACC TTTTATTGGT TGCCAGAATC
TAAGATTTAT TGGGCTTGAC CACTGTAAAG ATAAAAAAGA AGGATGCAAA CAAAGTGACC TAAGGAAGTG GCAGTTTCTC
CATAGCTTAT TAGTTTTGGA TCTCATTGAC ACTATCTGGT ACCAAGTATT TTCCGAAGAC ATGGCAGATC TTTTTGTTAA
CCTTAGGGAG CTAAATATAG TAGGAGTTTA TTGCTCTCAC ATATGGGGCC AGCTACAAAA TAAGATTGAA TATGTTGATT
TGTCTAGGAA AAGGAATATA AAACTTCCTT CCACTCTAAG ATTCTTCAGG CTTGATGACC GTCAACCTAC ACCGCAGTCC
ACACCGGGCA TTGAATTATC GCTAAAAGGT TGCATGGGAT TGGAAAGTTT ATTCCTGAGT CGAATATCCA ACCTCACGGA
GCTGGACCTC TCCGGAACTG CAATCAGGAT ACTTGACTTC ACAGCTATGG TGGTGGAAGT CTCAGGTTTG AAACGACTAT
TTCTGCTAGG ATGCAAGCAA CTCCAAGCAA TAAAATGGGA CAATAGTGGT TCAACGATAA AGCCGGACCT AGAGTTGTTG
TGCGTTGACA CAAGGTCTAG AAGTAAATAT CCTCAGTTAT TTGTTGACAA GAATAAATCC CCCGGTTTCT TGTCAGTCCA
TGCTGTTATT GTGGACGCGA GAATTGCTCG GTCCTTATGC GCTCTAATAG AGAACTCATA TCATGTTGAT ATGCATATCC
ATGTCACCTC TTCGACCATA TATGGTGAAG TTCAATCCGA AGGAACCTAC AAAGATAGCA TTAGCCAATT AAGTGATCAT
GTGAACATGC AGCAACAAGA CCTTATTTCA GCAGGCCAGT ACCATGATGT CCAACTTAGC ATGGTTGGCG ATGTCCCAAT
GCAGTCATTC CCCCTTCCTC CGACAACAAT GTTGAGCCGC CATATCGAGA TTGCACAGGG GAGCCACAAC CTGGAGAGCG
AGCTGGATGA TGATTCACCG ATTCTTACTT TAGCTCATCT AGTGCAGGGG AAGGCTGAGT CACTGCATGT GCATGATCTC
TCAACCATCA CTCCTTTGCC CGGAGGACAA TGGTGCTGTC TCAAGTGGTG TCGTATAGAG AGGTGCCCGA AGATAGAAAT
TGTCTTCCCT AAACACGCAT GGAATTTCTA CGGTCTGGAA ACCGCCTGGG TGTCGGATCT CTTGATGGCC CGTTGCATCT
GGAGTAAAGG TTCTCTCCAG TACAGTGGTT CCTTCCAAAA TCTGCAGCAC CTGCACCTGC GCAGCTGCCC AAGGCTCCAG
TTCGTGCTCC CGGTGTGGGC CTCCTCCTTC CCGGACCTGA AAACCCTCCA CGTCATCCAC TGCAGCAACC TCCACAACAT
CTTCGTGCTG GACGGAGATT ACCCAGAGCA AATAACCGTC GAAGGTGTAG CATTCCCGAA GCTAACCACC ATCCACCTGC
ACGACCTCCC GATGCTGCGG CAGATTTGCG ACGTCGAGTT CAAGATGGTG GCTCCCGCGC TCGAGACCAT CAAGATCAGG
GGATGCTGGG GCCTGCGCCG GCTGCCGGCC GTCGCTGCGG ATGGACCGAA GCCGGCCGTG GAGATCGAGA AGGACGTGTG
GGACGCGCTG GAGTGGGACG GGGTGGAAGC CGACCACCAC CCTTCCCTCT TCCAGGCGCC GGTGCACTCG CGCTACTACA
GGAAGAAGCT GCCCAGGGGC TCCGTCCTCA GGTATATATA CGGTGCATGC ATCGGACCAT GTACCTAGCT AGCTGCTCCA
TCTTGATTTA TTTGCATAAT ACTTGTTCTC AGTTATTTCA TTTGTTTGAT CTGTGCTTAA TCAATTTGCT TTCTCTGTCT
ACTGTTATAT TTGTTGCCTA GGTGAATTGA ATCCCTGGGC TTGGGCGGCC ATGATTTGGG GATTGATTGG CGACGAATGA
TGGTGAATCA GTGAGATGCT TCTTGCTTGC TTCTGTTGGG TGATTTGTCT CCGGTGATGT TGCAGCAAGC TTTGTGGTGT
GAGCTGTGTG ACGGGCACGG ACTGACCGTG GCTCGATCTT GTCCTCGTAT ATGGCCGAGT TGGCCAGAGA GCGAGATTGC
CATGGCTCTG AAATAATAAG CGGCTTTGTT TGTGCGTGGA TGCACAGACC AGCTGATTGA GTGAGTGTGT GTTTCTTGAA
TTTAATTAGC ATTCTGGGTG TGGATGCTCA GATGCATGTG TGTGTGTGGC TTGATATGAT GATCTGCTTT GCGTTTGAAA
CAATAATAAG CAGTAGCCAT TTGTGCCTGC GAGCATATGT ATGTGGCTGC TGCAGTGTGA CTGTGTGAGA GTGCATTGCT
TGTGTGTAAC TGAATTCTGA AGATTCTGAA CAGATGAGCA GCTGGTTGTG TGTGCTTGCT TGCATGCATG C

Locus: Os04g0431700

Loading...

Locus: Os04g0431700

Loading...