Os04t0432400-01

Locus

Os04g0432400

Description

Plant neutral invertase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NIN7

CGSNL Gene Name

NEUTRAL/ALKALINE INVERTASE 7

Oryzabase Gene Symbol Synonym(s)

OsNIN7

Oryzabase Gene Name Synonym(s)

neutral/alkaline invertase 7

Transcript Evidence

AK065562 (DDBJ, Best hit)

Protein Evidence

NP_001147920.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: catalytic activity (GO:0003824)

Functional domain (InterPro)

Plant neutral invertase (IPR006937)

Six-hairpin glycosidase-like (IPR008928)

Full-length cDNA

J013030A21 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0432400-01)

RiceXPro (AK065562)

Others

Oryzabase (14672)

KEGG (Os04t0432400-01)

Transcript

2121 bp

>Os04t0432400-01 Plant neutral invertase family protein.
AGCCGAAGCCGATCGAGCCAGAGACCGACCTCTCCTCCGCCGCACCGAACTCCGGCGAGC
CCACGTGAACACCACCACTCTCCGACGACCGTGCGTCTCGTTGCGTTTGGCTTCTCTTCT
CGTCGTCGTCGTCGTCGTCGCGTACGTACGGTGTGGTTCTTGAGGGCGGACGCGACGACG
GCGGCGGCGGTGTACGAGATGGAGGTGGCGGGGATGAGGAAGGCGTCGTCGCACGCGTCG
ATGGCGGCGGCGGCGGCGGACCCGGACGACTTCGACCTGACGCGGATGCTGAACCACCGG
CCGCGGATCAACGTGGACAGGCAGCGCTCCTTCGACGACCGCTCCCTCGCTGAGCTCTCC
ATCTCCGGCACGGCCAGCCGCGGCGGCGGCGGAGGAGGGTACCCGGCGATGATGGAGAGC
TACGAGAGCATGTACTCCCCCGGCGGCGGGCTCCGGTCCCTGTGCGGCACCCCGGCGTCC
TCCACCCGCCTCTCCTTCGACCCCCACCCCCTCGTCTTCGACGCCTGGGACGCCCTCCGC
CGCTCCCTCGTCTGCTTCCGCGGCCAGCCCCTCGGCACCATCGCCGCCGTCGACCACTCC
TCCGACGAGGTCCTCAACTACGACCAGGTGTTCGTGAGGGATTTCGTGCCGAGCGCGCTG
GCGTTCCTGATGAACGGGGAGCCGGAGATCGTGAAGAACTTCCTGCTCAAGACGCTGCTG
CTGCAGGGGTGGGAGAAGCGGATCGACAGGTTCAAGCTGGGGGAAGGGGCGATGCCGGCG
AGCTTCAAGGTGCTCAAGGACGCGAAGCGAGGAGGGGCGGAGCGGCTGGTGGCGGACTTC
GGGGAGAGCGCCATCGGGCGGGTGGCGCCGGTGGACTCCGGCTTCTGGTGGATCATCCTC
CTCCGCGCGTACACCAAGTCCACCGGCGACCTGTCGCTGGCGGAGACGGCGGAGTGCCAG
CGCGGGATCCGCCTCATCATGAACCAGTGCCTCGCCGAGGGCTTCGACACCTTCCCCACC
CTCCTCTGCGCCGACGGCTGCTGCATGATCGACCGCAGGATGGGCGTGTACGGGTACCCA
ATCGAGATCCAGGCCCTCTTCTTCATGGCGCTACGGTGCGCACTGCTGATGCTGAAGCCG
GACGCCCCCGAGGGGAAGGAGACGATGGACCGCGTGGCGACACGGCTCCACGCACTCACC
TACCACATGCGGTCCTACTTCTGGCTCGACTTCCAGCAGCTCAACGATGTCTACCGCTAC
CGCACCGAGGAGTACTCCCACACTGCGGTCAACAAGTTCAACGTCATCCCGGAGTCCATC
CCGGACTGGGTGTTCGACTTCATGCCCAGCCGCGGCGGCTACTTCGTCGGCAACGTCAGC
CCCGCCCGGATGGACTTCCGATGGTTCGCACTGGGCAACTTCGTCGCCATCCTTGCGTCC
ATGGCGACGCCCGAGCAGGCGGCGGCGATCATGGACCTCATCGAGGAGCGGTGGGAGGAC
CTCATCGGGGAGATGCCGCTCAAGATCAGCTTCCCGGCGATCGAATCACACGAGTGGGAG
TTCGTCACCGGGTGCGACCCCAAGAACACCCGGTGGAGCTACCACAATGGCGGATCCTGG
CCAGTGCTCCTGTGGCTGCTGACGGCGGCGTGCATCAAGACGGGGAGGCTGAAGATCGCG
AGGCGGGCGATCGAGCTCGCCGAGGCGAGGCTGGCGAGGGACGGGTGGCCGGAGTACTAC
GACGGGAAGCTGGGCCGCTACGTGGGCAAGCAGGCGAGGAAGCTGCAGACGTGGTCCGTC
GCCGGCTACCTCGTCGCCAAGATGATGGTGGAGGACCCCTCCCACCTCGGCATGATCTCC
CTCGAGGAGGACAGGGCCATGATGAAGCCCGTCCTCAAGCGCTCCGCCTCCTGGACCGTG
TAAATTACTAATTAATTATGGTGAAAAAACTTTGATTGATCCATGCAAAAAATAGTACAG
AAAGAAGAAAATGTGTTTGTTTTGGGGGATTTTCCGCTTTTTCACAAACCATTCGTTCCG
AATTTGGAAGGCGTGGTTTGGGCTAGCTATATGGTTGTGATCAGTTGTACACTATGTAAT
TAATGATCAAACATAGGGGGG

CDS

1725 bp

>Os04t0432400-01 Plant neutral invertase family protein.
ATGGAGGTGGCGGGGATGAGGAAGGCGTCGTCGCACGCGTCGATGGCGGCGGCGGCGGCG
GACCCGGACGACTTCGACCTGACGCGGATGCTGAACCACCGGCCGCGGATCAACGTGGAC
AGGCAGCGCTCCTTCGACGACCGCTCCCTCGCTGAGCTCTCCATCTCCGGCACGGCCAGC
CGCGGCGGCGGCGGAGGAGGGTACCCGGCGATGATGGAGAGCTACGAGAGCATGTACTCC
CCCGGCGGCGGGCTCCGGTCCCTGTGCGGCACCCCGGCGTCCTCCACCCGCCTCTCCTTC
GACCCCCACCCCCTCGTCTTCGACGCCTGGGACGCCCTCCGCCGCTCCCTCGTCTGCTTC
CGCGGCCAGCCCCTCGGCACCATCGCCGCCGTCGACCACTCCTCCGACGAGGTCCTCAAC
TACGACCAGGTGTTCGTGAGGGATTTCGTGCCGAGCGCGCTGGCGTTCCTGATGAACGGG
GAGCCGGAGATCGTGAAGAACTTCCTGCTCAAGACGCTGCTGCTGCAGGGGTGGGAGAAG
CGGATCGACAGGTTCAAGCTGGGGGAAGGGGCGATGCCGGCGAGCTTCAAGGTGCTCAAG
GACGCGAAGCGAGGAGGGGCGGAGCGGCTGGTGGCGGACTTCGGGGAGAGCGCCATCGGG
CGGGTGGCGCCGGTGGACTCCGGCTTCTGGTGGATCATCCTCCTCCGCGCGTACACCAAG
TCCACCGGCGACCTGTCGCTGGCGGAGACGGCGGAGTGCCAGCGCGGGATCCGCCTCATC
ATGAACCAGTGCCTCGCCGAGGGCTTCGACACCTTCCCCACCCTCCTCTGCGCCGACGGC
TGCTGCATGATCGACCGCAGGATGGGCGTGTACGGGTACCCAATCGAGATCCAGGCCCTC
TTCTTCATGGCGCTACGGTGCGCACTGCTGATGCTGAAGCCGGACGCCCCCGAGGGGAAG
GAGACGATGGACCGCGTGGCGACACGGCTCCACGCACTCACCTACCACATGCGGTCCTAC
TTCTGGCTCGACTTCCAGCAGCTCAACGATGTCTACCGCTACCGCACCGAGGAGTACTCC
CACACTGCGGTCAACAAGTTCAACGTCATCCCGGAGTCCATCCCGGACTGGGTGTTCGAC
TTCATGCCCAGCCGCGGCGGCTACTTCGTCGGCAACGTCAGCCCCGCCCGGATGGACTTC
CGATGGTTCGCACTGGGCAACTTCGTCGCCATCCTTGCGTCCATGGCGACGCCCGAGCAG
GCGGCGGCGATCATGGACCTCATCGAGGAGCGGTGGGAGGACCTCATCGGGGAGATGCCG
CTCAAGATCAGCTTCCCGGCGATCGAATCACACGAGTGGGAGTTCGTCACCGGGTGCGAC
CCCAAGAACACCCGGTGGAGCTACCACAATGGCGGATCCTGGCCAGTGCTCCTGTGGCTG
CTGACGGCGGCGTGCATCAAGACGGGGAGGCTGAAGATCGCGAGGCGGGCGATCGAGCTC
GCCGAGGCGAGGCTGGCGAGGGACGGGTGGCCGGAGTACTACGACGGGAAGCTGGGCCGC
TACGTGGGCAAGCAGGCGAGGAAGCTGCAGACGTGGTCCGTCGCCGGCTACCTCGTCGCC
AAGATGATGGTGGAGGACCCCTCCCACCTCGGCATGATCTCCCTCGAGGAGGACAGGGCC
ATGATGAAGCCCGTCCTCAAGCGCTCCGCCTCCTGGACCGTGTAA

Protein

575 aa

>Os04t0432400-01 Plant neutral invertase family protein.
MEVAGMRKASSHASMAAAAADPDDFDLTRMLNHRPRINVDRQRSFDDRSLAELSISGTAS
RGGGGGGYPAMMESYESMYSPGGGLRSLCGTPASSTRLSFDPHPLVFDAWDALRRSLVCF
RGQPLGTIAAVDHSSDEVLNYDQVFVRDFVPSALAFLMNGEPEIVKNFLLKTLLLQGWEK
RIDRFKLGEGAMPASFKVLKDAKRGGAERLVADFGESAIGRVAPVDSGFWWIILLRAYTK
STGDLSLAETAECQRGIRLIMNQCLAEGFDTFPTLLCADGCCMIDRRMGVYGYPIEIQAL
FFMALRCALLMLKPDAPEGKETMDRVATRLHALTYHMRSYFWLDFQQLNDVYRYRTEEYS
HTAVNKFNVIPESIPDWVFDFMPSRGGYFVGNVSPARMDFRWFALGNFVAILASMATPEQ
AAAIMDLIEERWEDLIGEMPLKISFPAIESHEWEFVTGCDPKNTRWSYHNGGSWPVLLWL
LTAACIKTGRLKIARRAIELAEARLARDGWPEYYDGKLGRYVGKQARKLQTWSVAGYLVA
KMMVEDPSHLGMISLEEDRAMMKPVLKRSASWTV*

5'UTR

chr04:21455841..21456038 (- strand) : 198 bp

CDS

chr04:21455412..21455840 (- strand) : 429 bp

chr04:21454411..21454845 (- strand) : 435 bp

chr04:21452589..21453150 (- strand) : 562 bp

chr04:21451824..21452122 (- strand) : 299 bp

3'UTR

chr04:21451626..21451823 (- strand) : 198 bp

FASTA

>Os04t0432400-01 class=Sequence position=chr04:21451626..21456038 (- strand)
AGCCGAAGCC GATCGAGCCA GAGACCGACC TCTCCTCCGC CGCACCGAAC TCCGGCGAGC CCACGTGAAC ACCACCACTC
TCCGACGACC GTGCGTCTCG TTGCGTTTGG CTTCTCTTCT CGTCGTCGTC GTCGTCGTCG CGTACGTACG GTGTGGTTCT
TGAGGGCGGA CGCGACGACG GCGGCGGCGG TGTACGAGAT GGAGGTGGCG GGGATGAGGA AGGCGTCGTC GCACGCGTCG
ATGGCGGCGG CGGCGGCGGA CCCGGACGAC TTCGACCTGA CGCGGATGCT GAACCACCGG CCGCGGATCA ACGTGGACAG
GCAGCGCTCC TTCGACGACC GCTCCCTCGC TGAGCTCTCC ATCTCCGGCA CGGCCAGCCG CGGCGGCGGC GGAGGAGGGT
ACCCGGCGAT GATGGAGAGC TACGAGAGCA TGTACTCCCC CGGCGGCGGG CTCCGGTCCC TGTGCGGCAC CCCGGCGTCC
TCCACCCGCC TCTCCTTCGA CCCCCACCCC CTCGTCTTCG ACGCCTGGGA CGCCCTCCGC CGCTCCCTCG TCTGCTTCCG
CGGCCAGCCC CTCGGCACCA TCGCCGCCGT CGACCACTCC TCCGACGAGG TCCTCAACTA CGACCAGGTA TACCAAGTCC
TCAACTTCTA GCAGCCATAG GGTctgtttg gaggagcttt tagctgctgc aactttaccc agaattagaa gtttcctcaa
atagtccagc ttttagacta gattcttaga agctgtagat gtagaatcca gaaaatgaac tagaaatcag aaactgaaaa
acccagcttt tttctagatt cttagaagct agctaccaac cagctgcttc tcagaatttt aattttaagc tccccaaaca
tgcccATAGT CTCCCACGGA CGTAATCTTG AGCTCCTCAA ACAATTCACA TGTgttcaaa attccggaat aaattttcga
aattttgttc ctatcggaaa accccaaaat ttttaaatta ttacatttta atttagtaaa atttgttcaa atttaaacaa
attttattta aaaattcaaa taatctcatc atatcagcac ccccgataca aatgccaaaa acgaaagatt gaaccctgct
ACCAATCAGC ATATATTCTC AAAATCTTAA AAGCAACAAT CTGATCGATG AAACTGCACG CATATACACG CAGGTGTTCG
TGAGGGATTT CGTGCCGAGC GCGCTGGCGT TCCTGATGAA CGGGGAGCCG GAGATCGTGA AGAACTTCCT GCTCAAGACG
CTGCTGCTGC AGGGGTGGGA GAAGCGGATC GACAGGTTCA AGCTGGGGGA AGGGGCGATG CCGGCGAGCT TCAAGGTGCT
CAAGGACGCG AAGCGAGGAG GGGCGGAGCG GCTGGTGGCG GACTTCGGGG AGAGCGCCAT CGGGCGGGTG GCGCCGGTGG
ACTCCGGCTT CTGGTGGATC ATCCTCCTCC GCGCGTACAC CAAGTCCACC GGCGACCTGT CGCTGGCGGA GACGGCGGAG
TGCCAGCGCG GGATCCGCCT CATCATGAAC CAGTGCCTCG CCGAGGGCTT CGACACCTTC CCCACCCTCC TCTGCGCCGA
CGGCTGCTGC ATGATCGACC GCAGGATGGT ATGTACTACT GTCGTTCGTT CGTCCTCACT AGCTTCATGT TTGTTCGTTA
TTGTTGATTA TCATGATCGC CGTAATTTAT CTAGTTTTTC AATTAAAAAA ACTGATTTTC TTTTTGGATT TATATGTtac
tccttccgtt tcaggttata agacgttttg actttggtca aaattaaact gctttaaatt tgatcaagat ggtagagaaa
attagtaaca ctttcaaccc aaagcaaatt tattatgaaa atatattcaa ttattgattt gataaaacta atttagtatt
ataaatatta ctatatttgt ctataaattt agtcaaattt aaaacagact aaaatcaaaa tgtcttataa cttgaaacgg
agggagtaGT ATTGTTGATA ATGATCACCA TAATTAATCT AGTTTGTCAA TTTAAAAAAA AAACTTATTT TTTACACCTA
TATGTTATTA TTGTTGATAA TGATCACCAT ATCTACTTTT ATATGCCATC AAAGAGTTAA AAAAAATAGT TTGTGCTGAT
CATTTTGGCA TCAGTTGCTA AATGAATTTT GGGTGAGGCT CCTTACCGGA TGAATTTAGC TGCCAGAAAA AAAAAAGTTT
CTGCTTTAGC TGATAATAAA GAACATAATG CTGAAAAATT TTGTTACTGA TCACTGTCTG GTTAATTGAT CCCAATAATC
AAAACAGAAA AAAAAAGCAC TGTTTGTACA TGCATGCAGC TACTGCAGCT CGGTCAAACT AACCGTAACC ATCCATATCC
TAATCGATAG AAATTAAAAC GACTCCCATT CCCAGAAATA AATCGATAAC TACACATTTA CGCTGATGGA TACGATCTGA
CACCGACGGT GTCGTGGTCA CCATGGAATC GAAACTGAAC TCTCTGAAAA ATGAAATGAA AAGCCAACGC AGTGCCAACA
AGCAGCATCG ACGCTTCTCG AGTGGTGAAA TGCTACCGCA CGGCACCAGC AAAGCACCAA GAAGATCCTG CGGACACTAA
TACTGCTAGT CGTATGAGAG ATATGGAAGG AAAGGAACCG CATGATCTTT CGGCGACTAG CCTAATAGCC AAAATTAAGG
AGAGGCCAAA ACATGAATCT TGACGAACAC AAAGCATCTA CGGTAGCTGG CTTACGTTTT AGCAATCTCG GGCAAAAGGC
TTTGAGCCTT TACATTTTTT TCTCTTGCGC CTGAATAGTT TTACTCCTTT TTTATTCAAT AAAAATTTAA ATGATTTTTT
TTTTGCAGGG CGTGTACGGG TACCCAATCG AGATCCAGGC CCTCTTCTTC ATGGCGCTAC GGTGCGCACT GCTGATGCTG
AAGCCGGACG CCCCCGAGGG GAAGGAGACG ATGGACCGCG TGGCGACACG GCTCCACGCA CTCACCTACC ACATGCGGTC
CTACTTCTGG CTCGACTTCC AGCAGCTCAA CGATGTCTAC CGCTACCGCA CCGAGGAGTA CTCCCACACT GCGGTCAACA
AGTTCAACGT CATCCCGGAG TCCATCCCGG ACTGGGTGTT CGACTTCATG CCCAGCCGCG GCGGCTACTT CGTCGGCAAC
GTCAGCCCCG CCCGGATGGA CTTCCGATGG TTCGCACTGG GCAACTTCGT CGCCATCCTT GCGTCCATGG CGACGCCCGA
GCAGGCGGCG GCGATCATGG ACCTCATCGA GGAGCGGTGG GAGGACCTCA TCGGGGAGAT GCCGCTCAAG ATCAGCTTCC
CGGCGATCGA ATCACACGAG TGGGAGTTCG TCACCGGGTG CGACCCCAAG AACACCCGGT GGAGCTACCA CAATGGCGGA
TCCTGGCCAG GTTAGTTATT TTGTACTTCG ATTGTTTCTA TCCTTAGAAA ATATAATACC TTCCGATACC TTATTAAGAA
TGATAAAATT ACATCCTACA AATCCCTCCC TTTGAAGTCA CGGAAACATG CTGTTCCGAA CGTGTTTCAA GTCATGTTTT
AAGAATTTTG AACATTTTCT TTTGAGGGGA AGAAAAAAAA ATTGAACATT GATATTTTCT TTGAAAAATG ATTAGACCAT
TAGAAGTATG AAAACCATAT GCATTTAATT TTTCTGTAAA AAAAACATTT ATTAGTACTA CAATGACGCA CCCAAATCTG
CTCACATTTT TCTTTTCTTA AAACAATTTT AACGATTTTT TAGTTGGCAT GTATAAAACG AGTGTACGAT CCACTCGAGT
GACCAAATGA GTAGTTATCT CATCTAACGA TCCGAGCATG TTTGTTTTGT GTTGTGTGTT AATTTGCGGC GGCCAGTGCT
CCTGTGGCTG CTGACGGCGG CGTGCATCAA GACGGGGAGG CTGAAGATCG CGAGGCGGGC GATCGAGCTC GCCGAGGCGA
GGCTGGCGAG GGACGGGTGG CCGGAGTACT ACGACGGGAA GCTGGGCCGC TACGTGGGCA AGCAGGCGAG GAAGCTGCAG
ACGTGGTCCG TCGCCGGCTA CCTCGTCGCC AAGATGATGG TGGAGGACCC CTCCCACCTC GGCATGATCT CCCTCGAGGA
GGACAGGGCC ATGATGAAGC CCGTCCTCAA GCGCTCCGCC TCCTGGACCG TGTAAATTAC TAATTAATTA TGGTGAAAAA
ACTTTGATTG ATCCATGCAA AAAATAGTAC AGAAAGAAGA AAATGTGTTT GTTTTGGGGG ATTTTCCGCT TTTTCACAAA
CCATTCGTTC CGAATTTGGA AGGCGTGGTT TGGGCTAGCT ATATGGTTGT GATCAGTTGT ACACTATGTA ATTAATGATC
AAACATAGGG GGG

Locus: Os04g0432400

Loading...

Locus: Os04g0432400

Loading...