Os04t0432400-02

Locus

Os04g0432400

Description

Similar to neutral/alkaline invertase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NIN7

CGSNL Gene Name

NEUTRAL/ALKALINE INVERTASE 7

Oryzabase Gene Symbol Synonym(s)

OsNIN7

Oryzabase Gene Name Synonym(s)

neutral/alkaline invertase 7

Transcript Evidence

AK061496 (DDBJ, Best hit)

Protein Evidence

NP_001147920.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: catalytic activity (GO:0003824)

Functional domain (InterPro)

Plant neutral invertase (IPR006937)

Six-hairpin glycosidase-like (IPR008928)

Full-length cDNA

006-309-D01 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0432400-02)

RiceXPro (AK061496)

Others

Oryzabase (14672)

KEGG (Os04t0432400-02)

Transcript

938 bp

>Os04t0432400-02 Similar to neutral/alkaline invertase.
ATGTCTACCGCTACCGCACCGAGGAGTACTCCCACACTGCGGTCAACAAGTTCAACGTCA
TCCCGGAGTCCATCCCGGACTGGGTGTTCGACTTCATGCCCAGCCGCGGCGGCTACTTCG
TCGGCAACGTCAGCCCCGCCCGGATGGACTTCCGATGGTTCGCACTGGGCAACTTCGTCG
CCATCCTTGCGTCCATGGCGACGCCCGAGCAGGCGGCGGCGATCATGGACCTCATCGAGG
AGCGGTGGGAGGACCTCATCGGGGAGATGCCGCTCAAGATCAGCTTCCCGGCGATCGAAT
CACACGAGTGGGAGTTCGTCACCGGGTGCGACCCCAAGAACACCCGGTGGAGCTACCACA
ATGGCGGATCCTGGCCAGTGCTCCTGTGGCTGCTGACGGCGGCGTGCATCAAGACGGGGA
GGCTGAAGATCGCGAGGCGGGCGATCGAGCTCGCCGAGGCGAGGCTGGCGAGGGACGGGT
GGCCGGAGTACTACGACGGGAAGCTGGGCCGCTACGTGGGCAAGCAGGCGAGGAAGCTGC
AGACGTGGTCCGTCGCCGGCTACCTCGTCGCCAAGATGATGGTGGAGGACCCCTCCCACC
TCGGCATGATCTCCCTCGAGGAGGACAGGGCCATGATGAAGCCCGTCCTCAAGCGCTCCG
CCTCCTGGACCGTGTAAATTACTAATTAATTATGGTGAAAAAACTTTGATTGATCCATGC
AAAAAATAGTACAGAAAGAAGAAAATGTGTTTGTTTTGGGGGATTTTCCGCTTTTTCACA
AACCATTCGTTCCGAATTTGGAAGGCGTGGTTTGGGCTAGCTATATGGTTGTGATCAGTT
GTACACTATGTAATTAATGATCAAACATAGGGGGGAAAAGAATATGTGGATGTCACATGG
ACTGAACTTTTACCGTGGAATTTAAACATTTCACACTC

CDS

675 bp

>Os04t0432400-02 Similar to neutral/alkaline invertase.
GTCTACCGCTACCGCACCGAGGAGTACTCCCACACTGCGGTCAACAAGTTCAACGTCATC
CCGGAGTCCATCCCGGACTGGGTGTTCGACTTCATGCCCAGCCGCGGCGGCTACTTCGTC
GGCAACGTCAGCCCCGCCCGGATGGACTTCCGATGGTTCGCACTGGGCAACTTCGTCGCC
ATCCTTGCGTCCATGGCGACGCCCGAGCAGGCGGCGGCGATCATGGACCTCATCGAGGAG
CGGTGGGAGGACCTCATCGGGGAGATGCCGCTCAAGATCAGCTTCCCGGCGATCGAATCA
CACGAGTGGGAGTTCGTCACCGGGTGCGACCCCAAGAACACCCGGTGGAGCTACCACAAT
GGCGGATCCTGGCCAGTGCTCCTGTGGCTGCTGACGGCGGCGTGCATCAAGACGGGGAGG
CTGAAGATCGCGAGGCGGGCGATCGAGCTCGCCGAGGCGAGGCTGGCGAGGGACGGGTGG
CCGGAGTACTACGACGGGAAGCTGGGCCGCTACGTGGGCAAGCAGGCGAGGAAGCTGCAG
ACGTGGTCCGTCGCCGGCTACCTCGTCGCCAAGATGATGGTGGAGGACCCCTCCCACCTC
GGCATGATCTCCCTCGAGGAGGACAGGGCCATGATGAAGCCCGTCCTCAAGCGCTCCGCC
TCCTGGACCGTGTAA

Protein

225 aa

>Os04t0432400-02 Similar to neutral/alkaline invertase.
VYRYRTEEYSHTAVNKFNVIPESIPDWVFDFMPSRGGYFVGNVSPARMDFRWFALGNFVA
ILASMATPEQAAAIMDLIEERWEDLIGEMPLKISFPAIESHEWEFVTGCDPKNTRWSYHN
GGSWPVLLWLLTAACIKTGRLKIARRAIELAEARLARDGWPEYYDGKLGRYVGKQARKLQ
TWSVAGYLVAKMMVEDPSHLGMISLEEDRAMMKPVLKRSASWTV*

5'UTR

chr04:21452965..21452966 (- strand) : 2 bp

CDS

chr04:21452589..21452964 (- strand) : 376 bp

chr04:21451824..21452122 (- strand) : 299 bp

3'UTR

chr04:21451563..21451823 (- strand) : 261 bp

FASTA

>Os04t0432400-02 class=Sequence position=chr04:21451563..21452966 (- strand)
ATGTCTACCG CTACCGCACC GAGGAGTACT CCCACACTGC GGTCAACAAG TTCAACGTCA TCCCGGAGTC CATCCCGGAC
TGGGTGTTCG ACTTCATGCC CAGCCGCGGC GGCTACTTCG TCGGCAACGT CAGCCCCGCC CGGATGGACT TCCGATGGTT
CGCACTGGGC AACTTCGTCG CCATCCTTGC GTCCATGGCG ACGCCCGAGC AGGCGGCGGC GATCATGGAC CTCATCGAGG
AGCGGTGGGA GGACCTCATC GGGGAGATGC CGCTCAAGAT CAGCTTCCCG GCGATCGAAT CACACGAGTG GGAGTTCGTC
ACCGGGTGCG ACCCCAAGAA CACCCGGTGG AGCTACCACA ATGGCGGATC CTGGCCAGGT TAGTTATTTT GTACTTCGAT
TGTTTCTATC CTTAGAAAAT ATAATACCTT CCGATACCTT ATTAAGAATG ATAAAATTAC ATCCTACAAA TCCCTCCCTT
TGAAGTCACG GAAACATGCT GTTCCGAACG TGTTTCAAGT CATGTTTTAA GAATTTTGAA CATTTTCTTT TGAGGGGAAG
AAAAAAAAAT TGAACATTGA TATTTTCTTT GAAAAATGAT TAGACCATTA GAAGTATGAA AACCATATGC ATTTAATTTT
TCTGTAAAAA AAACATTTAT TAGTACTACA ATGACGCACC CAAATCTGCT CACATTTTTC TTTTCTTAAA ACAATTTTAA
CGATTTTTTA GTTGGCATGT ATAAAACGAG TGTACGATCC ACTCGAGTGA CCAAATGAGT AGTTATCTCA TCTAACGATC
CGAGCATGTT TGTTTTGTGT TGTGTGTTAA TTTGCGGCGG CCAGTGCTCC TGTGGCTGCT GACGGCGGCG TGCATCAAGA
CGGGGAGGCT GAAGATCGCG AGGCGGGCGA TCGAGCTCGC CGAGGCGAGG CTGGCGAGGG ACGGGTGGCC GGAGTACTAC
GACGGGAAGC TGGGCCGCTA CGTGGGCAAG CAGGCGAGGA AGCTGCAGAC GTGGTCCGTC GCCGGCTACC TCGTCGCCAA
GATGATGGTG GAGGACCCCT CCCACCTCGG CATGATCTCC CTCGAGGAGG ACAGGGCCAT GATGAAGCCC GTCCTCAAGC
GCTCCGCCTC CTGGACCGTG TAAATTACTA ATTAATTATG GTGAAAAAAC TTTGATTGAT CCATGCAAAA AATAGTACAG
AAAGAAGAAA ATGTGTTTGT TTTGGGGGAT TTTCCGCTTT TTCACAAACC ATTCGTTCCG AATTTGGAAG GCGTGGTTTG
GGCTAGCTAT ATGGTTGTGA TCAGTTGTAC ACTATGTAAT TAATGATCAA ACATAGGGGG GAAAAGAATA TGTGGATGTC
ACATGGACTG AACTTTTACC GTGGAATTTA AACATTTCAC ACTC

Locus: Os04g0432400

Loading...

Locus: Os04g0432400

Loading...