Os04t0439600-01

Locus

Os04g0439600

Description

Regulator of chromosome condensation/beta-lactamase-inhibitor protein II domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCRR1

Oryzabase Gene Name Synonym(s)

CRINKLY4-RELATED protein 1

Transcript Evidence

AK109788 (DDBJ, Best hit)

Protein Evidence

Q01K77 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, active site (IPR008271)

Regulator of chromosome condensation/beta-lactamase-inhibitor protein II (IPR009091)

Protein kinase-like domain (IPR011009)

Concanavalin A-like lectin/glucanase, subgroup (IPR013320)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Full-length cDNA

002-147-D03 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0439600-01)

RiceXPro (AK109788)

Others

Oryzabase (10377)

KEGG (Os04t0439600-01)

Transcript

2844 bp

>Os04t0439600-01 Regulator of chromosome condensation/beta-lactamase-inhibitor protein II domain containing protein.
TTTCCCCTTCTCCATCTTCTTCCTCCTCCTCCCCAACTCGCGCCAACAATGGTCGTCTCC
ACAAACTCCTCCTCCTCCTCCTCTCCTCCAACCCAATGTCTCCACCTCACCTCCTCCTCC
TCCTCCTAGCCCTCCTCCTCTCGCCGCCCCTCCTCCTCGCCTCCTCCTCCTTCCCCCTCC
CCACCATCGCCATCGCCGCCGTCTCCAACTCCAGCTCCAACCCCTCCAAGCAGCATCTCG
CGTGCGGGCTCGTGCCGGCGGCGGGGGGCGCGGCGGCGGGGTACAGGATCTCGTGCGCCA
GCGTGTCGAACAGGTCGGCGGCGGCGCCGCACGTGTACGCGTATGGCGGGGACGGGACGT
GCTCGCCGTACTCGGCGGTGGTCGCCGGGGACGGGTACCTGTGCTCGGCTGCGCCGACGT
CGTCGCCGCCAATGTCGATGCGGTGGTGGGATCTGAACGAGGCCGGGGATGGGTCGAAGC
GGGTGTACAGGGGGCGGGTGCTCTCGGCGGTGTCCGGCGGCGGGGAGTCCGTGTGCGGGC
TCGTCGGGGAGAGGATGCAGTGCTGGAGGTGCCCGTGGGGGGAGGGCGCGCCGGCGAGGG
TGGGGTTCTCGGCGGTGGCGGTGGGTGGCGGGTTCGTGTGCGGGTTGGTGGTGGGGAGCG
GGGAGGTGAGGTGCTATGGTGGAGGGGAGGTGGTGGGGAGGGAGCCCGCGGGGAGGAGGT
TCATGCTGCTCGCCGCCGGCGAGAGGCACGCGTGCGGCGTGGATGATGGCGGGGTGGTGG
GTTGCTGGGGGGAGGCGGCGGCGGTGGCGGCCGCGTCGCCGCCGAGGATCAGCCGCGCGG
TGTCGACGGTGGCGGTGGGCGACGCGGTCACGTGCGTGCTGTGGGGGAACTGGACGGTCT
CGTGCTGGCCCGAGGGGGAGGCGTCGCCGCCGCCGGCGCTGGCGGGGCAGCAGTTCGTCG
CGCTGGAGGCGAAGGGGAAGGTGGTGTGCGGGGTGCTCATGTCCGACTACTCGCTGCAGT
GCTGGGGCGCAGGCGTCGCGGGCGGGGTGAGGAAGGTGTTCGACAAGGTGCTCCCGGGTC
CGTGCGCGCCGTCGAAGTCGTGCTCGTGCGGCGTCTGGTCGGGCTCCGCGCAGCTCTGCG
CCGGCAGCGGCGGGGGAGGCGGCGGAGACGTGTCCGTTTGTTACCCCTGCGGCTACACCC
CTCCTCCGATGGCGCTGTCCCCGACGTCCAACTCGTCGTCGTCGTCGAGCTCTCAATCGA
AGGGGAAGCGTCGCCCGAGCAATCTGGCGATAGCGTTGATCAGCGCCGGAGCTGGATCGG
CGCTCGTGGCGCTCCTCGCCGCGCTCGCGGCGGTTTACTACCTGCGCCGGCACCGTGGCA
GCAGCTCGCCGGTCTCCGGGCGCATCCACGCCGAGCCGACGGGCACGGCGCCGCGCGTGG
AGCGGCGGCTCAGCGCGCTGCTCTCCAAGGGCCCGAACACGACGGTCGAGCAGTTCCCGC
TGGTGGCGCTCCGCGCCGCCACCGACTGCTTCTCGCCGGCGAAGCGCATCGGCTCCGGCA
GCTTCGGCGCGGTGTACCGCGCGTCCCTCCCCGACGGCCGCGAGGTCGCCATCAAGCGCG
CCGAGCGCCGCGACACGGGGGGCCCTTCCTCCTCCTCCGCCGCCGCGGCGCGGCGCGTCG
ACCACGAGGCGGCATTCGTCTCCGAGCTCGCGCTCCTCTCCCGCGTCAACCACAAGAACC
TGGTCCGCCTCCTCGGCTTCTGCGCCGACGGCGGCGAGCGCATCCTCGTCTACGAGTTCA
TGCCCAACGGCACCCTCCACGACCACCTCCACAGGCGTGCGGCGTCGGCGGCGGCGCCGC
TCTCCCCGCCGCTCGCCTCCTGGCCGTCCCGCCTCCGCCTCGCGCTCGGCGCCGCCCGCG
GCATCGAGTACATGCACACCTACGCCGTCCCGCCCatcatccaccgcgacatcaagtcct
ccaacatcctcctcgactcctgctggaccgccaaggtctccgacttcggCCTCTCCCTCC
TCAACACCCTGGACGGTGACAATGCCGCCGCCGGCGACGGAGGCAATGCCGGCGACGGAG
ACGACGAGGAGCGGTGCGTGACGGCGGGGACGGTGGGGTACATGGACCCGGAgtactaca
ggctgcagcacctgacggacaagagcgacgtgtacagcttcggcgtcgtgctgctggagc
tgctgtccgggtgcAAGGCAATCCAGAAGTACGAGGGCAGCGGCTCGCCCAAGAACGTGG
TGGACATGGCCGTGCCGCACATCGAGGGCGACCGGGTGCACCGGGTGCTCGACGCGAGGc
tgccgctgccgacgccgtgggagatggaggccgtcgcctacgtcggctacctggcggccg
actgcgtcaggctggccggccgcgaccgccccaccatgagcgaggtcgtgggcgtgctcg
agcgggccgtggcggcgtgcgacgagtacgaggaaggcggcgccggcgccggcggcgagc
ccgcgctgtcgCGGTCGTGCACCGATGGGTCCACGGCGACGTGACGTGGCATGTCGTGGA
ATGGAATGCCCCCATTTGCATGGTTGGCCTCCCTTGCGCAAGAACAACGGGGAGGAGAGT
TTTCTTTTGAGGATTTTTTGTTTGTTTTATTGTTATTGCTTAGCATTAGTCACAGAACAT
TCATTAGTATTTTATAGAAAAGAATCAAAATTTTAGTGTAAATGGTCTTCTGACATTGTT
TTGATTTGAAATATTTTTGGGTTTTCTCCCCCCTTTTTTGTTCTTTTCTGGTCTTAATAT
ACATATATTGAAGTCTTCCTCGAC

CDS

2469 bp

>Os04t0439600-01 Regulator of chromosome condensation/beta-lactamase-inhibitor protein II domain containing protein.
ATGTCTCCACCTCACCTCCTCCTCCTCCTCCTAGCCCTCCTCCTCTCGCCGCCCCTCCTC
CTCGCCTCCTCCTCCTTCCCCCTCCCCACCATCGCCATCGCCGCCGTCTCCAACTCCAGC
TCCAACCCCTCCAAGCAGCATCTCGCGTGCGGGCTCGTGCCGGCGGCGGGGGGCGCGGCG
GCGGGGTACAGGATCTCGTGCGCCAGCGTGTCGAACAGGTCGGCGGCGGCGCCGCACGTG
TACGCGTATGGCGGGGACGGGACGTGCTCGCCGTACTCGGCGGTGGTCGCCGGGGACGGG
TACCTGTGCTCGGCTGCGCCGACGTCGTCGCCGCCAATGTCGATGCGGTGGTGGGATCTG
AACGAGGCCGGGGATGGGTCGAAGCGGGTGTACAGGGGGCGGGTGCTCTCGGCGGTGTCC
GGCGGCGGGGAGTCCGTGTGCGGGCTCGTCGGGGAGAGGATGCAGTGCTGGAGGTGCCCG
TGGGGGGAGGGCGCGCCGGCGAGGGTGGGGTTCTCGGCGGTGGCGGTGGGTGGCGGGTTC
GTGTGCGGGTTGGTGGTGGGGAGCGGGGAGGTGAGGTGCTATGGTGGAGGGGAGGTGGTG
GGGAGGGAGCCCGCGGGGAGGAGGTTCATGCTGCTCGCCGCCGGCGAGAGGCACGCGTGC
GGCGTGGATGATGGCGGGGTGGTGGGTTGCTGGGGGGAGGCGGCGGCGGTGGCGGCCGCG
TCGCCGCCGAGGATCAGCCGCGCGGTGTCGACGGTGGCGGTGGGCGACGCGGTCACGTGC
GTGCTGTGGGGGAACTGGACGGTCTCGTGCTGGCCCGAGGGGGAGGCGTCGCCGCCGCCG
GCGCTGGCGGGGCAGCAGTTCGTCGCGCTGGAGGCGAAGGGGAAGGTGGTGTGCGGGGTG
CTCATGTCCGACTACTCGCTGCAGTGCTGGGGCGCAGGCGTCGCGGGCGGGGTGAGGAAG
GTGTTCGACAAGGTGCTCCCGGGTCCGTGCGCGCCGTCGAAGTCGTGCTCGTGCGGCGTC
TGGTCGGGCTCCGCGCAGCTCTGCGCCGGCAGCGGCGGGGGAGGCGGCGGAGACGTGTCC
GTTTGTTACCCCTGCGGCTACACCCCTCCTCCGATGGCGCTGTCCCCGACGTCCAACTCG
TCGTCGTCGTCGAGCTCTCAATCGAAGGGGAAGCGTCGCCCGAGCAATCTGGCGATAGCG
TTGATCAGCGCCGGAGCTGGATCGGCGCTCGTGGCGCTCCTCGCCGCGCTCGCGGCGGTT
TACTACCTGCGCCGGCACCGTGGCAGCAGCTCGCCGGTCTCCGGGCGCATCCACGCCGAG
CCGACGGGCACGGCGCCGCGCGTGGAGCGGCGGCTCAGCGCGCTGCTCTCCAAGGGCCCG
AACACGACGGTCGAGCAGTTCCCGCTGGTGGCGCTCCGCGCCGCCACCGACTGCTTCTCG
CCGGCGAAGCGCATCGGCTCCGGCAGCTTCGGCGCGGTGTACCGCGCGTCCCTCCCCGAC
GGCCGCGAGGTCGCCATCAAGCGCGCCGAGCGCCGCGACACGGGGGGCCCTTCCTCCTCC
TCCGCCGCCGCGGCGCGGCGCGTCGACCACGAGGCGGCATTCGTCTCCGAGCTCGCGCTC
CTCTCCCGCGTCAACCACAAGAACCTGGTCCGCCTCCTCGGCTTCTGCGCCGACGGCGGC
GAGCGCATCCTCGTCTACGAGTTCATGCCCAACGGCACCCTCCACGACCACCTCCACAGG
CGTGCGGCGTCGGCGGCGGCGCCGCTCTCCCCGCCGCTCGCCTCCTGGCCGTCCCGCCTC
CGCCTCGCGCTCGGCGCCGCCCGCGGCATCGAGTACATGCACACCTACGCCGTCCCGCCC
atcatccaccgcgacatcaagtcctccaacatcctcctcgactcctgctggaccgccaag
gtctccgacttcggCCTCTCCCTCCTCAACACCCTGGACGGTGACAATGCCGCCGCCGGC
GACGGAGGCAATGCCGGCGACGGAGACGACGAGGAGCGGTGCGTGACGGCGGGGACGGTG
GGGTACATGGACCCGGAgtactacaggctgcagcacctgacggacaagagcgacgtgtac
agcttcggcgtcgtgctgctggagctgctgtccgggtgcAAGGCAATCCAGAAGTACGAG
GGCAGCGGCTCGCCCAAGAACGTGGTGGACATGGCCGTGCCGCACATCGAGGGCGACCGG
GTGCACCGGGTGCTCGACGCGAGGctgccgctgccgacgccgtgggagatggaggccgtc
gcctacgtcggctacctggcggccgactgcgtcaggctggccggccgcgaccgccccacc
atgagcgaggtcgtgggcgtgctcgagcgggccgtggcggcgtgcgacgagtacgaggaa
ggcggcgccggcgccggcggcgagcccgcgctgtcgCGGTCGTGCACCGATGGGTCCACG
GCGACGTGA

Protein

823 aa

>Os04t0439600-01 Regulator of chromosome condensation/beta-lactamase-inhibitor protein II domain containing protein.
MSPPHLLLLLLALLLSPPLLLASSSFPLPTIAIAAVSNSSSNPSKQHLACGLVPAAGGAA
AGYRISCASVSNRSAAAPHVYAYGGDGTCSPYSAVVAGDGYLCSAAPTSSPPMSMRWWDL
NEAGDGSKRVYRGRVLSAVSGGGESVCGLVGERMQCWRCPWGEGAPARVGFSAVAVGGGF
VCGLVVGSGEVRCYGGGEVVGREPAGRRFMLLAAGERHACGVDDGGVVGCWGEAAAVAAA
SPPRISRAVSTVAVGDAVTCVLWGNWTVSCWPEGEASPPPALAGQQFVALEAKGKVVCGV
LMSDYSLQCWGAGVAGGVRKVFDKVLPGPCAPSKSCSCGVWSGSAQLCAGSGGGGGGDVS
VCYPCGYTPPPMALSPTSNSSSSSSSQSKGKRRPSNLAIALISAGAGSALVALLAALAAV
YYLRRHRGSSSPVSGRIHAEPTGTAPRVERRLSALLSKGPNTTVEQFPLVALRAATDCFS
PAKRIGSGSFGAVYRASLPDGREVAIKRAERRDTGGPSSSSAAAARRVDHEAAFVSELAL
LSRVNHKNLVRLLGFCADGGERILVYEFMPNGTLHDHLHRRAASAAAPLSPPLASWPSRL
RLALGAARGIEYMHTYAVPPIIHRDIKSSNILLDSCWTAKVSDFGLSLLNTLDGDNAAAG
DGGNAGDGDDEERCVTAGTVGYMDPEYYRLQHLTDKSDVYSFGVVLLELLSGCKAIQKYE
GSGSPKNVVDMAVPHIEGDRVHRVLDARLPLPTPWEMEAVAYVGYLAADCVRLAGRDRPT
MSEVVGVLERAVAACDEYEEGGAGAGGEPALSRSCTDGSTAT*

5'UTR

chr04:21881686..21881780 (- strand) : 95 bp

CDS

chr04:21879217..21881685 (- strand) : 2469 bp

3'UTR

chr04:21878937..21879216 (- strand) : 280 bp

FASTA

>Os04t0439600-01 class=Sequence position=chr04:21878937..21881780 (- strand)
TTTCCCCTTC TCCATCTTCT TCCTCCTCCT CCCCAACTCG CGCCAACAAT GGTCGTCTCC ACAAACTCCT CCTCCTCCTC
CTCTCCTCCA ACCCAATGTC TCCACCTCAC CTCCTCCTCC TCCTCCTAGC CCTCCTCCTC TCGCCGCCCC TCCTCCTCGC
CTCCTCCTCC TTCCCCCTCC CCACCATCGC CATCGCCGCC GTCTCCAACT CCAGCTCCAA CCCCTCCAAG CAGCATCTCG
CGTGCGGGCT CGTGCCGGCG GCGGGGGGCG CGGCGGCGGG GTACAGGATC TCGTGCGCCA GCGTGTCGAA CAGGTCGGCG
GCGGCGCCGC ACGTGTACGC GTATGGCGGG GACGGGACGT GCTCGCCGTA CTCGGCGGTG GTCGCCGGGG ACGGGTACCT
GTGCTCGGCT GCGCCGACGT CGTCGCCGCC AATGTCGATG CGGTGGTGGG ATCTGAACGA GGCCGGGGAT GGGTCGAAGC
GGGTGTACAG GGGGCGGGTG CTCTCGGCGG TGTCCGGCGG CGGGGAGTCC GTGTGCGGGC TCGTCGGGGA GAGGATGCAG
TGCTGGAGGT GCCCGTGGGG GGAGGGCGCG CCGGCGAGGG TGGGGTTCTC GGCGGTGGCG GTGGGTGGCG GGTTCGTGTG
CGGGTTGGTG GTGGGGAGCG GGGAGGTGAG GTGCTATGGT GGAGGGGAGG TGGTGGGGAG GGAGCCCGCG GGGAGGAGGT
TCATGCTGCT CGCCGCCGGC GAGAGGCACG CGTGCGGCGT GGATGATGGC GGGGTGGTGG GTTGCTGGGG GGAGGCGGCG
GCGGTGGCGG CCGCGTCGCC GCCGAGGATC AGCCGCGCGG TGTCGACGGT GGCGGTGGGC GACGCGGTCA CGTGCGTGCT
GTGGGGGAAC TGGACGGTCT CGTGCTGGCC CGAGGGGGAG GCGTCGCCGC CGCCGGCGCT GGCGGGGCAG CAGTTCGTCG
CGCTGGAGGC GAAGGGGAAG GTGGTGTGCG GGGTGCTCAT GTCCGACTAC TCGCTGCAGT GCTGGGGCGC AGGCGTCGCG
GGCGGGGTGA GGAAGGTGTT CGACAAGGTG CTCCCGGGTC CGTGCGCGCC GTCGAAGTCG TGCTCGTGCG GCGTCTGGTC
GGGCTCCGCG CAGCTCTGCG CCGGCAGCGG CGGGGGAGGC GGCGGAGACG TGTCCGTTTG TTACCCCTGC GGCTACACCC
CTCCTCCGAT GGCGCTGTCC CCGACGTCCA ACTCGTCGTC GTCGTCGAGC TCTCAATCGA AGGGGAAGCG TCGCCCGAGC
AATCTGGCGA TAGCGTTGAT CAGCGCCGGA GCTGGATCGG CGCTCGTGGC GCTCCTCGCC GCGCTCGCGG CGGTTTACTA
CCTGCGCCGG CACCGTGGCA GCAGCTCGCC GGTCTCCGGG CGCATCCACG CCGAGCCGAC GGGCACGGCG CCGCGCGTGG
AGCGGCGGCT CAGCGCGCTG CTCTCCAAGG GCCCGAACAC GACGGTCGAG CAGTTCCCGC TGGTGGCGCT CCGCGCCGCC
ACCGACTGCT TCTCGCCGGC GAAGCGCATC GGCTCCGGCA GCTTCGGCGC GGTGTACCGC GCGTCCCTCC CCGACGGCCG
CGAGGTCGCC ATCAAGCGCG CCGAGCGCCG CGACACGGGG GGCCCTTCCT CCTCCTCCGC CGCCGCGGCG CGGCGCGTCG
ACCACGAGGC GGCATTCGTC TCCGAGCTCG CGCTCCTCTC CCGCGTCAAC CACAAGAACC TGGTCCGCCT CCTCGGCTTC
TGCGCCGACG GCGGCGAGCG CATCCTCGTC TACGAGTTCA TGCCCAACGG CACCCTCCAC GACCACCTCC ACAGGCGTGC
GGCGTCGGCG GCGGCGCCGC TCTCCCCGCC GCTCGCCTCC TGGCCGTCCC GCCTCCGCCT CGCGCTCGGC GCCGCCCGCG
GCATCGAGTA CATGCACACC TACGCCGTCC CGCCCatcat ccaccgcgac atcaagtcct ccaacatcct cctcgactcc
tgctggaccg ccaaggtctc cgacttcggC CTCTCCCTCC TCAACACCCT GGACGGTGAC AATGCCGCCG CCGGCGACGG
AGGCAATGCC GGCGACGGAG ACGACGAGGA GCGGTGCGTG ACGGCGGGGA CGGTGGGGTA CATGGACCCG GAgtactaca
ggctgcagca cctgacggac aagagcgacg tgtacagctt cggcgtcgtg ctgctggagc tgctgtccgg gtgcAAGGCA
ATCCAGAAGT ACGAGGGCAG CGGCTCGCCC AAGAACGTGG TGGACATGGC CGTGCCGCAC ATCGAGGGCG ACCGGGTGCA
CCGGGTGCTC GACGCGAGGc tgccgctgcc gacgccgtgg gagatggagg ccgtcgccta cgtcggctac ctggcggccg
actgcgtcag gctggccggc cgcgaccgcc ccaccatgag cgaggtcgtg ggcgtgctcg agcgggccgt ggcggcgtgc
gacgagtacg aggaaggcgg cgccggcgcc ggcggcgagc ccgcgctgtc gCGGTCGTGC ACCGATGGGT CCACGGCGAC
GTGACGTGGC ATGTCGTGGA ATGGAATGCC CCCATTTGCA TGGTTGGCCT CCCTTGCGCA AGAACAACGG GGAGGAGAGT
TTTCTTTTGA GGATTTTTTG TTTGTTTTAT TGTTATTGCT TAGCATTAGT CACAGAACAT TCATTAGTAT TTTATAGAAA
AGAATCAAAA TTTTAGTGTA AATGGTCTTC TGACATTGTT TTGATTTGAA ATATTTTTGG GTTTTCTCCC CCCTTTTTTG
TTCTTTTCTG GTCTTAATAT ACATATATTG AAGTCTTCCT CGAC

Locus: Os04g0439600

Loading...

Locus: Os04g0439600

Loading...