Os04t0464200-01

Locus

Os04g0464200

Description

Betaine aldehyde dehydrogenase, Rice fragrance, Salt stress

RAP-DB Gene Symbol Synonym(s)

BAD1, Badh1, badh1, BAD1, BADH1, OsBADH1, BADH

RAP-DB Gene Name Synonym(s)

BETAINE ALDEHYDE DEHYDROGENASE 1, betaine aldehyde dehydrogenase 1

CGSNL Gene Symbol

BAD1

CGSNL Gene Name

BETAINE ALDEHYDE DEHYDROGENASE 1

Oryzabase Gene Symbol Synonym(s)

Badh1, badh1, BAD1, BADH1, OsBADH1, BADH, OsALDH10A5, ALDH10A5

Oryzabase Gene Name Synonym(s)

betaine aldehyde dehydrogenase 1, Aldehyde dehydrogenase 10A5

Transcript Evidence

AK103582 (Genbank)

Protein Evidence

O24174 (UniProt)

Literature

PMID: 9193078

PMID: 17129318

Note

Manual Curation

July 14, 2009

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (GO:0016620)

Functional domain (InterPro)

Aldehyde dehydrogenase domain (IPR015590)

Aldehyde dehydrogenase, conserved site (IPR016160)

Aldehyde/histidinol dehydrogenase (IPR016161)

Aldehyde dehydrogenase, N-terminal (IPR016162)

Aldehyde dehydrogenase, C-terminal (IPR016163)

Full-length cDNA

J033133A13 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0464200-01)

RiceXPro (AK103582)

Others

Oryzabase (8197)

KEGG (Os04t0464200-01 (EC:1.2.1.3, EC:1.2.1.8))

Transcript

1907 bp

>Os04t0464200-01 Betaine aldehyde dehydrogenase, Rice fragrance, Salt stress
GGTGAGAGAGAGTGCTCGTCGTCGATCGCCCAAGGTCCGGGACAACCCAAAAGGCCGCGG
CGACAGCGGAGCAGCAGCAGCAGCAGCTCGCGCCGCCCCCCAACCGGAAGCCATGGCCGC
GCCGTCGGCGATCCCCCGCCGCGGCCTGTTCATCGGCGGCGGGTGGCGGGAGCCGTCCCT
CGGCCGCCGCCTCCCCGTCGTCAACCCGGCCACGGAGGCAACCATCGGTGACATCCCGGC
GGCCACGGCGGAGGACGTCGAGCTCGCGGTGTCGGCGGCGAGGGATGCGTTCGGCCGCGA
CGGTGGGAGACACTGGTCGCGCGCGCCTGGGGCCGTGCGGGCCAAGTACCTCAAGGCGAT
CGCCGCTAAGATTAAAGATAAGAAATCTTATCTAGCTTTGTTGGAGACTCTTGATTCTGG
GAAGCCTCTGGATGAAGCAGCTGGGGACATGGAGGATGTCGCTGCATGCTTTGAGTATTA
TGCTGATCTGGCAGAAGCTTTAGATGGGAAACAACGGGCACCAATCTCTCTACCCATGGA
AAATTTTGAGTCCTATGTACTCAAAGAACCCATTGGGGTTGTTGGACTTATCACTCCCTG
GAATTATCCTCTGCTGATGGCTACTTGGAAGGTTGCACCTGCCCTGGCTGCTGGGTGTAC
AGCTGTATTAAAGCCATCTGAGCTTGCTTCCCTGACATGTTTAGAGCTTGGTGGAATATG
TGCAGAAATTGGATTACCTCCAGGAGTCTTGAACATAATTACTGGTCTGGGCACTGAAGC
TGGTGCTCCATTAGCTTCACATCCCCATGTGGATAAGATTGCTTTTACTGGAAGCACAGA
AACTGGTAAGAGGATAATGATTACTGCTTCCCAAATGGTCAAGCCTGTTTCGTTAGAGCT
TGGTGGCAAAAGTCCTCTTATTGTCTTTGATGATGTTGATATTGATAAAGCTGTTGAGTG
GGCCATGTTTGGGTGTTTTGCGAACGCTGGTCAAGTCTGCAGTGCTACTTCTCGTCTACT
TTTGCATgagaaaattgcaaagcgattcttggataggttggttgcatgggcaaagagtat
caaaatctcagatccactagaagaaggttgcaggctggggtcagtcgttagtgaagGGCA
GTATCAAAAAATAATGAAGTTCATCTCAACAGCAAGATGTGAAGGTGCCACAATTCTATA
TGGGGGTGCCCGACCACAAcacctcaaaagggggttctttattgagcctactattataac
aaatgttagcacatcaatgcaaatttggcgagaggaagtctttggaccggtcatctgcgt
taaagaatttaggacagagcgtgaagcagtagaacttGCAAATGATACTCACTATGGTCT
AGCTGGCGCTGTGATTTCCAATGATCTAGAGAGGTGCGAGCGCATTTCAAAGGCTATCCA
GTCAGGTATCGTTTGGATAAATTGCTCGCAACCATGCTTTGTTCAAGCTCCATGGGGAGG
GAACAAGCGGAGTGGTTTTGGCCGGGAGCTAGGACAGTGGGGCCTCGATAACTACTTGAG
CGTGAAGCAAGTCACCAAGTACTGCTCAGATGAACCATACGGATGGTACCGGCCTCCATC
CAAGCTGTAGATTTGTCATTCGTGTCAAGAGCGACGGAGCACGTCATTACCTGAAAGCAA
GATCAACCCTGTACATTCAGAACGGACGGACAGAATCTTCTTTACAGTTGCTCTTACGGT
CTTACAATAAGCCTTGCATGGCAATAGCAACTTATGAATTACAGTATATGATACTGCGTC
ATCAAGCAAGCCATGTGTGTGCTGTATCAGACTATCATTCGCTTTGTCGAGCACCTGCAT
TTGTCACCACTCACCACTGTTAAAGCAAGAATGCAAAATGCAAAATG

CDS

1518 bp

>Os04t0464200-01 Betaine aldehyde dehydrogenase, Rice fragrance, Salt stress
ATGGCCGCGCCGTCGGCGATCCCCCGCCGCGGCCTGTTCATCGGCGGCGGGTGGCGGGAG
CCGTCCCTCGGCCGCCGCCTCCCCGTCGTCAACCCGGCCACGGAGGCAACCATCGGTGAC
ATCCCGGCGGCCACGGCGGAGGACGTCGAGCTCGCGGTGTCGGCGGCGAGGGATGCGTTC
GGCCGCGACGGTGGGAGACACTGGTCGCGCGCGCCTGGGGCCGTGCGGGCCAAGTACCTC
AAGGCGATCGCCGCTAAGATTAAAGATAAGAAATCTTATCTAGCTTTGTTGGAGACTCTT
GATTCTGGGAAGCCTCTGGATGAAGCAGCTGGGGACATGGAGGATGTCGCTGCATGCTTT
GAGTATTATGCTGATCTGGCAGAAGCTTTAGATGGGAAACAACGGGCACCAATCTCTCTA
CCCATGGAAAATTTTGAGTCCTATGTACTCAAAGAACCCATTGGGGTTGTTGGACTTATC
ACTCCCTGGAATTATCCTCTGCTGATGGCTACTTGGAAGGTTGCACCTGCCCTGGCTGCT
GGGTGTACAGCTGTATTAAAGCCATCTGAGCTTGCTTCCCTGACATGTTTAGAGCTTGGT
GGAATATGTGCAGAAATTGGATTACCTCCAGGAGTCTTGAACATAATTACTGGTCTGGGC
ACTGAAGCTGGTGCTCCATTAGCTTCACATCCCCATGTGGATAAGATTGCTTTTACTGGA
AGCACAGAAACTGGTAAGAGGATAATGATTACTGCTTCCCAAATGGTCAAGCCTGTTTCG
TTAGAGCTTGGTGGCAAAAGTCCTCTTATTGTCTTTGATGATGTTGATATTGATAAAGCT
GTTGAGTGGGCCATGTTTGGGTGTTTTGCGAACGCTGGTCAAGTCTGCAGTGCTACTTCT
CGTCTACTTTTGCATgagaaaattgcaaagcgattcttggataggttggttgcatgggca
aagagtatcaaaatctcagatccactagaagaaggttgcaggctggggtcagtcgttagt
gaagGGCAGTATCAAAAAATAATGAAGTTCATCTCAACAGCAAGATGTGAAGGTGCCACA
ATTCTATATGGGGGTGCCCGACCACAAcacctcaaaagggggttctttattgagcctact
attataacaaatgttagcacatcaatgcaaatttggcgagaggaagtctttggaccggtc
atctgcgttaaagaatttaggacagagcgtgaagcagtagaacttGCAAATGATACTCAC
TATGGTCTAGCTGGCGCTGTGATTTCCAATGATCTAGAGAGGTGCGAGCGCATTTCAAAG
GCTATCCAGTCAGGTATCGTTTGGATAAATTGCTCGCAACCATGCTTTGTTCAAGCTCCA
TGGGGAGGGAACAAGCGGAGTGGTTTTGGCCGGGAGCTAGGACAGTGGGGCCTCGATAAC
TACTTGAGCGTGAAGCAAGTCACCAAGTACTGCTCAGATGAACCATACGGATGGTACCGG
CCTCCATCCAAGCTGTAG

Protein

505 aa

>Os04t0464200-01 Betaine aldehyde dehydrogenase, Rice fragrance, Salt stress
MAAPSAIPRRGLFIGGGWREPSLGRRLPVVNPATEATIGDIPAATAEDVELAVSAARDAF
GRDGGRHWSRAPGAVRAKYLKAIAAKIKDKKSYLALLETLDSGKPLDEAAGDMEDVAACF
EYYADLAEALDGKQRAPISLPMENFESYVLKEPIGVVGLITPWNYPLLMATWKVAPALAA
GCTAVLKPSELASLTCLELGGICAEIGLPPGVLNIITGLGTEAGAPLASHPHVDKIAFTG
STETGKRIMITASQMVKPVSLELGGKSPLIVFDDVDIDKAVEWAMFGCFANAGQVCSATS
RLLLHEKIAKRFLDRLVAWAKSIKISDPLEEGCRLGSVVSEGQYQKIMKFISTARCEGAT
ILYGGARPQHLKRGFFIEPTIITNVSTSMQIWREEVFGPVICVKEFRTEREAVELANDTH
YGLAGAVISNDLERCERISKAIQSGIVWINCSQPCFVQAPWGGNKRSGFGRELGQWGLDN
YLSVKQVTKYCSDEPYGWYRPPSKL*

5'UTR

chr04:23176221..23176332 (- strand) : 112 bp

CDS

chr04:23176106..23176220 (- strand) : 115 bp

chr04:23175850..23175992 (- strand) : 143 bp

chr04:23175029..23175109 (- strand) : 81 bp

chr04:23174794..23174942 (- strand) : 149 bp

chr04:23174081..23174173 (- strand) : 93 bp

chr04:23173876..23173999 (- strand) : 124 bp

chr04:23173689..23173754 (- strand) : 66 bp

chr04:23173476..23173542 (- strand) : 67 bp

chr04:23173228..23173304 (- strand) : 77 bp

chr04:23173044..23173157 (- strand) : 114 bp

chr04:23172654..23172731 (- strand) : 78 bp

chr04:23172418..23172569 (- strand) : 152 bp

chr04:23172281..23172341 (- strand) : 61 bp

chr04:23172037..23172143 (- strand) : 107 bp

chr04:23171793..23171883 (- strand) : 91 bp

3'UTR

chr04:23171516..23171792 (- strand) : 277 bp

FASTA

>Os04t0464200-01 class=Sequence position=chr04:23171516..23176332 (- strand)
GGTGAGAGAG AGTGCTCGTC GTCGATCGCC CAAGGTCCGG GACAACCCAA AAGGCCGCGG CGACAGCGGA GCAGCAGCAG
CAGCAGCTCG CGCCGCCCCC CAACCGGAAG CCATGGCCGC GCCGTCGGCG ATCCCCCGCC GCGGCCTGTT CATCGGCGGC
GGGTGGCGGG AGCCGTCCCT CGGCCGCCGC CTCCCCGTCG TCAACCCGGC CACGGAGGCA ACCATCGGTA CTCCGTCCCT
TTGCTTTTGC CCCCCATATC CCCTTCGCCC GCATTTGGTT TGCTCCATCC CAAGCACGGG ATTCCGGTTA ATTTGTTTGT
GGGTTTTGTG ATCGGTGAAG GTGACATCCC GGCGGCCACG GCGGAGGACG TCGAGCTCGC GGTGTCGGCG GCGAGGGATG
CGTTCGGCCG CGACGGTGGG AGACACTGGT CGCGCGCGCC TGGGGCCGTG CGGGCCAAGT ACCTCAAGGC GATCGCCGCT
AAGGTGCTCA GCTTCTATGC CTCCTAATCC TGCTATTAGT TTGGACTTTG GAGCTAGATG AGTTGTTGAG CAGAGCTCTC
CTATGCTGCT AACCTGCTAC TTCCACCTTG CTGTGTGACT GAAACTTACT TTCGGGGATT GATTAAAGGA CGCTCTTAGT
GCCGTAAACT GCTTCTCAAA TTAGGTTGAT CAACTCGGGT TTAGTATTGA AAAGAAAATT CATACTTATG TCCCATTTTT
ATTGCAAGTC GGTATTTTAC TTCTGTTGTA TATGATCATA GGAAGGGGGT GCACATAACA ATATATTAGG AACAGTAGGA
AAAATTGGAA CAACATATCA GGAACAGTGA AAAATCATGG CTAGTTTAGT CTAGCGGAAA TTATGTTTAC TGGAAGCTGT
CAATGGGTAG CAGATGAGAT TCTCCACTAA AGACAATGTT GACTTGCCCT TGCTGTTACA ACGAGTTCAC TGTTGATTAT
CTTTGAACAA TGGGTTTCTC AGACTTCAGT TTTTACAGAT GGAAGCTTTC TCAGATTGAA TGTTATTTCC AGTATGTTTA
CTTAGTTTAC CCTTTTTGCT GAACTTTAAA TGGAAAGCCC CAAGGCTGAA ATTTTTGTTA TGATGAGAAG CCCATAGTAT
AACTTGATCG GTGCTTTTAA CAATTGGTGC CCACCCTGTC ATTAGTATTT TTGTTTGTTA TAACCGGCAG TACATTTATT
GAAATGTTGT GAACTGGCTG CAGATTAAAG ATAAGAAATC TTATCTAGCT TTGTTGGAGA CTCTTGATTC TGGGAAGCCT
CTGGATGAAG CAGCTGGGGA CATGGTATGC ATTATTATTC ACACTATGGT TTTTAGCATG ACACAAGATT TTCCGTGCTT
TATTTGATGC CTTGGCCTTG TTAATTTTAG GAGGATGTCG CTGCATGCTT TGAGTATTAT GCTGATCTGG CAGAAGCTTT
AGATGGGAAA CAACGGGCAC CAATCTCTCT ACCCATGGAA AATTTTGAGT CCTATGTACT CAAAGAACCC ATTGGGGTTG
TTGGACTTAT CACTCCCTGG TATAAGAAAT ACATACCTTG CCTTGAAAAA TTGATACTGT TTAATTGTAT CATAGTATAT
TTTTTTGGCT TCTGGGATGT TGTAGTGTAT CGAAATACTT TGACACGTCC AATTTCCCTC GTCTTATTAG ACTCAAGGTG
TTTTGTTCAC ACCGGAAGCA ATTGTTCTTA TTTCAGTCTT TTCATGCTTT TGTTGGTTCA TGTTTGATAA CAGAAGACCA
ATTGGAAATT TCAAATTCCT CATGTTTTGC ATCTGTAGTT TTGTTTTCCT GTCAGAGGAA AGACTATTAA CAAAATATCA
TGATCCTTTT GTATTGTTTA CCTTTTGTAC GTGATCATCC AATAACTTTG AAGTTGATCT TCCCAAGCCC CCTTCAGGTA
TTCATACCAA TCTAAAACTC TAAAAGTGCT ATGTTGATCC ATAAAAAATA GTGGTGGCGT TCATTGCCAC CTGTTGATTC
CTATCACATG AGTACAGACA TGCACCCCTA TAACATATTG ATGTTTTCCG TGTTTCATTG CTTTGTGTAA ATGCGCTTTA
GGCTTATGAG ATAAAGAAAT TTGAGTTATA GTAAAAGGCT AATCGTTTGG ATTATTTTCT TATTCATGCA CACATGAAGG
AATTATCCTC TGCTGATGGC TACTTGGAAG GTTGCACCTG CCCTGGCTGC TGGGTGTACA GCTGTATTAA AGCCATCTGA
GCTTGCTTCC CTGTAAGGAT CTAAGGATTG ATCATTTACA ATTCATTTAT GCAAGGTTTG TACCCCATGA CTAAAAATAT
GTTTTTAAAC CAGGACATGT TTAGAGCTTG GTGGAATATG TGCAGAAATT GGATTACCTC CAGGAGTCTT GAACATAATT
ACTGGTCTGG GCACTGAAGC TGGTGCTCCA TTAGCTTCAC ATCCCCATGT GGATAAGGTC AGACCTCTTC CTAATATGTA
CTACATTCAT GTGCTTACAA ACACACTGAC AGAGTATCAC ATATTTTTAA GTGACTACCC TAAGTTGTTT TTGAATTTTA
TGTGGATCCT TTCTGTAGAT TGCTTTTACT GGAAGCACAG AAACTGGTAA GAGGATAATG ATTACTGCTT CCCAAATGGT
CAAGGTTTGT TCTCTATATA TGATCATGCC CTGAAGAGAA TTTCTAATAA CTTCTGACAT TGAATGCTTC TGTCGGAGCA
AGAAACCTGT GCATTATGCC TTGATGTCCT CGTAAGTCTA ATTATATTGT GCTTTTTTTT TCTTGAACAG CCTGTTTCGT
TAGAGCTTGG TGGCAAAAGT CCTCTTATTG TCTTTGATGA TGTTGATATT GATAAAGGTA TTAGGTATCT TCCACTCTCC
AGCTTTCCCA CGTCAACTAT GCTCCTAATT CAATTATGCG ATGTTGTCAA ACCACTTGTT TTTTGTTTAA TTCATTACCT
GCAATTCTGT AGTTATTCAA GTAAGTATTG CTAGCTAATT GTATGTGTAT GTGCTAAATT TGAAACAGCT GTTGAGTGGG
CCATGTTTGG GTGTTTTGCG AACGCTGGTC AAGTCTGCAG TGCTACTTCT CGTCTACTTT TGCATGTACG TATGTTCTTC
TGCTTATTTT ACAGCTTAAG TCATGTCCTC GTACATGACA TGAAGATAtg cacaggagaa aattgcaaag cgattcttgg
ataggttggt tgcatgggca aagagtatca aaatctcaga tccactagaa gaaggttgca ggctggggtc agtcgttagt
gaagGGCAGG TAATGTAAAT AGCTTATTGC AGCTCCTGAA GTTCAGTTGC AAATATTCAT TTCTCTTGTG AAGTGTGAAC
CTGTGAACTT TGATGAATAT TTCACGTCAT TCAAAACAAA ATTATTGCTC AAGATAATAG TGAAATACTA AAAATGCATG
TAACAGTAAT AGTTTACTTC TTTGGAAATT GCTTTTCTTG CAAATATTGT ATTCTGCAGC CATGCCTTTC TATACAGCCT
TAGATACCTT GTCATCTGAA TAACTGCATC ATTATGTAAT TCGGTAACTC GGACGACTTA AGAACCTTTT TCTCATTTCA
GTATCAAAAA ATAATGAAGT TCATCTCAAC AGCAAGATGT GAAGGTGCCA CAATTCTATA TGGGGGTGCC CGACCACAAG
TATGTATCCT TAGACTTCAA GTTACATTAG TCCTTGGTTC CTCAGTATTT GATCCTAACC AAGCTAAATT GGTGTACTGa
cagcacctca aaagggggtt ctttattgag cctactatta taacaaatgt tagcacatca atgcaaattt ggcgagagga
agtctttgga ccggtcatct gcgttaaaga atttaggaca gagcgtgaag cagtagaact tGCAAATGAT ACTCAGTGAG
TTGCTTTATG TGGAACTGTG GAAAAAAAAA TTAAGCCTGT TCTTGTCTTT TTAATCTGCT TCTTTTCTCA GCTATGGTCT
AGCTGGCGCT GTGATTTCCA ATGATCTAGA GAGGTGCGAG CGCATTTCAA AGGTAATTTT GGGTTGAATT ACGACGTGCC
TATCAATTTT ACCCTTGACT AAATAGCTGG GACCCTGGGA TGATGATAAC CTGGTAATGA AATGGATGTA TTTGATCTCA
TAAATCCACA ATACATGTGA AACCTGCAGG CTATCCAGTC AGGTATCGTT TGGATAAATT GCTCGCAACC ATGCTTTGTT
CAAGCTCCAT GGGGAGGGAA CAAGCGGAGT GGTTTTGGCC GGGAGCTAGG ACAGTGGTGA GTCTATTACT ATACTTATTT
AGAACAGTAA ACTCATACAA ATGTGATAAG CAGTTAATCC GCAGTGCTTG ATGTCACAAA CTGTGGCCAA CTGAACAAGC
ATTGGCTGTG CAATCTACAT CCTCTGAAAT GTCTTTGCTT ATGCTTCAGG GGCCTCGATA ACTACTTGAG CGTGAAGCAA
GTCACCAAGT ACTGCTCAGA TGAACCATAC GGATGGTACC GGCCTCCATC CAAGCTGTAG ATTTGTCATT CGTGTCAAGA
GCGACGGAGC ACGTCATTAC CTGAAAGCAA GATCAACCCT GTACATTCAG AACGGACGGA CAGAATCTTC TTTACAGTTG
CTCTTACGGT CTTACAATAA GCCTTGCATG GCAATAGCAA CTTATGAATT ACAGTATATG ATACTGCGTC ATCAAGCAAG
CCATGTGTGT GCTGTATCAG ACTATCATTC GCTTTGTCGA GCACCTGCAT TTGTCACCAC TCACCACTGT TAAAGCAAGA
ATGCAAAATG CAAAATG

Locus: Os04g0464200

Loading...

Locus: Os04g0464200

Loading...