Os04t0465300-01

Locus

Os04g0465300

Description

A member of the GAST (gibberellin (GA)-Stimulated Transcript) family, Cell division, Differentiation of panicles

RAP-DB Gene Symbol Synonym(s)

GASR2, OsGASR2

RAP-DB Gene Name Synonym(s)

GA-stimulated transcript homolog 2, GA-stimulated transcript-related gene 2

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsGASR2, GASR2

Oryzabase Gene Name Synonym(s)

GAST (GA-stimulated transcript) homolog 2, GAST homolog 2, GA-stimulated transcript homolog 2, GA-stimulated transcript-related gene 2

Transcript Evidence

AK240853

AB192575

Protein Evidence

Q7X885

Literature

PMID: 16905871

Note

Manual Curation

June 15, 2017

Functional domain (InterPro)

Gibberellin regulated protein (IPR003854)

Experimentally confirmed subcellular location

apoplast (GO:0048046)

cell wall (GO:0005618)

Full-length cDNA

J065021D20 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0465300-01)

Others

Oryzabase (14272)

KEGG (Os04t0465300-01)

Transcript

684 bp

>Os04t0465300-01 A member of the GAST (gibberellin (GA)-Stimulated Transcript) family, Cell division, Differentiation of panicles
TGCCAGCCAGCCAGCCACTCATCAATCACTCAAGGCCCCTCCTCCTCTCTCCATCAAGAG
AAGCTCtacctcggcccgtcctcgcccgccggccggccgccgtcgccatggctcccggca
agctcgcggtgttcgccctcctggcgtctctcctcctccTCAACACCATCAAGGCCGCAG
ACTACCCTCCGGCTCCTCCCCTTGGGCCGCCTCCCCACAAGATCGTAGACCCCGGCAAAG
ACTGCGTGGGGGCGTGCGACGCGCGGTGCAGCGAGCACTCGCACAAGAAGCGGTGCAGCC
GCTCCTGCCTCACGTGCTGCAGCGCGTGCCGCTGCGTCCCGGCGGGCACGGCCGGCAACC
GGGAGACCTGCGGCAGGTGCTACACCGACTGGGTCTCGCACAACAACATGACCAAGTGCC
CGTGAGCTAAGCGCGCACGAATACGATCCGTCTGCCTGCCTAGATCTAGCTTAATTTAGC
TTTGCATTGCTCCTAGTTGAGTAGTTGGTGTTGTCCGTTGGGTTTCTGTCTTTCCAGAGT
TATCCTTTTTTCTTTTTCTTTTTTTTTCTTCCTGAGAGAAGAGAGGGTGTTGACGAGCTG
TTACTGTTAGTATTCTGGACCTCTAGTATGTTTTGTTGTGTAAAAAAGGACTAGTGAAAT
CCATCTCGGCTTGAATCACGCTTG

CDS

318 bp

>Os04t0465300-01 A member of the GAST (gibberellin (GA)-Stimulated Transcript) family, Cell division, Differentiation of panicles
atggctcccggcaagctcgcggtgttcgccctcctggcgtctctcctcctccTCAACACC
ATCAAGGCCGCAGACTACCCTCCGGCTCCTCCCCTTGGGCCGCCTCCCCACAAGATCGTA
GACCCCGGCAAAGACTGCGTGGGGGCGTGCGACGCGCGGTGCAGCGAGCACTCGCACAAG
AAGCGGTGCAGCCGCTCCTGCCTCACGTGCTGCAGCGCGTGCCGCTGCGTCCCGGCGGGC
ACGGCCGGCAACCGGGAGACCTGCGGCAGGTGCTACACCGACTGGGTCTCGCACAACAAC
ATGACCAAGTGCCCGTGA

Protein

105 aa

>Os04t0465300-01 A member of the GAST (gibberellin (GA)-Stimulated Transcript) family, Cell division, Differentiation of panicles
MAPGKLAVFALLASLLLLNTIKAADYPPAPPLGPPPHKIVDPGKDCVGACDARCSEHSHK
KRCSRSCLTCCSACRCVPAGTAGNRETCGRCYTDWVSHNNMTKCP*

5'UTR

chr04:23243093..23243199 (- strand) : 107 bp

CDS

chr04:23243027..23243092 (- strand) : 66 bp

chr04:23242852..23242918 (- strand) : 67 bp

chr04:23242561..23242745 (- strand) : 185 bp

3'UTR

chr04:23242302..23242560 (- strand) : 259 bp

FASTA

>Os04t0465300-01 class=Sequence position=chr04:23242302..23243199 (- strand)
TGCCAGCCAG CCAGCCACTC ATCAATCACT CAAGGCCCCT CCTCCTCTCT CCATCAAGAG AAGCTCtacc tcggcccgtc
ctcgcccgcc ggccggccgc cgtcgccatg gctcccggca agctcgcggt gttcgccctc ctggcgtctc tcctcctccT
CAACACCATC AAGGTAAAAG CACACACAAA TGCACAACTA GCTGCATAAA CACACACATT CATGTGTTCT CTTCTTGTGC
TCTAATAGTT GGCCGAATGC ATGGTTGCTT GTATTTTGTA GGCCGCAGAC TACCCTCCGG CTCCTCCCCT TGGGCCGCCT
CCCCACAAGA TCGTAGACCC CGGCAAAGGT ATGTACTGCA CGGTGCCCAC ATTTGCCTGA ACAACCCGAG GCAGCTCATT
TCATTGTGCT ACTGATGATA ACCTGGCGCG CTTGGTTGGT TGGTTTGGTG GCAGACTGCG TGGGGGCGTG CGACGCGCGG
TGCAGCGAGC ACTCGCACAA GAAGCGGTGC AGCCGCTCCT GCCTCACGTG CTGCAGCGCG TGCCGCTGCG TCCCGGCGGG
CACGGCCGGC AACCGGGAGA CCTGCGGCAG GTGCTACACC GACTGGGTCT CGCACAACAA CATGACCAAG TGCCCGTGAG
CTAAGCGCGC ACGAATACGA TCCGTCTGCC TGCCTAGATC TAGCTTAATT TAGCTTTGCA TTGCTCCTAG TTGAGTAGTT
GGTGTTGTCC GTTGGGTTTC TGTCTTTCCA GAGTTATCCT TTTTTCTTTT TCTTTTTTTT TCTTCCTGAG AGAAGAGAGG
GTGTTGACGA GCTGTTACTG TTAGTATTCT GGACCTCTAG TATGTTTTGT TGTGTAAAAA AGGACTAGTG AAATCCATCT
CGGCTTGAAT CACGCTTG

Locus: Os04g0465300

Loading...

Locus: Os04g0465300

Loading...