Os04t0465700-01

Locus

Os04g0465700

Description

RNA-dependent RNA polymerase, eukaryotic-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RDR2

CGSNL Gene Name

RNA-DEPENDENT RNA POLYMERASE 2

Oryzabase Gene Symbol Synonym(s)

OsRDR2

Oryzabase Gene Name Synonym(s)

RNA-dependent RNA polymerase 2, Probable RNA-dependent RNA polymerase 2

Transcript Evidence

AK064379 (DDBJ, Best hit)

Protein Evidence

Q19VG2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: RNA-directed RNA polymerase activity (GO:0003968)

Functional domain (InterPro)

RNA-dependent RNA polymerase, eukaryotic-type (IPR007855)

Full-length cDNA

002-108-D10 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0465700-01)

RiceXPro (AK064379)

Others

Oryzabase (8343)

KEGG (Os04t0465700-01 (EC:2.7.7.48))

Transcript

1618 bp

>Os04t0465700-01 RNA-dependent RNA polymerase, eukaryotic-type domain containing protein.
CATATTTTTATAATGATGACGGGAAAACAGCCACAGTTGTTGGAAAAGTTGCAATCACAA
AAAATCCGTGTCTCCATCCTGGTGATATCCGAGTACTTGAAGCCATCTATGACCCTGATT
TGGTGGGCATGGTTGATTGTCTTGTCTTCCCTCAAAGAGGAGAAAGGCCTCATCCAAACG
AATGCTCGGGGGGAGATTTGGACGGCGACCTCTATTTTATTACTTGGGATGACAAACTTA
TTCCAGAGAAAGTTGATACACCTATGGACTACACAGCAACAAGGCCGCGCATAATGGATC
ATGTTGTTACACTCGAGGAAATTCAGAAGCACTTTGTTGATTACATGATAAATGACTCGC
TTGGTGCCATCTCAACTGCCCACTTGATTCACGCGGACCGTTCGCCACTGAAAGCTCGGA
GTCCCGAGTGCCTCCAGCTGGCAACTCTGCATTCCATGGCAGTTGACTTCGCCAAGACGG
GAGCTCCAGCTGAAATGCCGCGAACATTGAGGCCGAGGGAGTACCCCGACTTCATGGAAC
GGTGGGAGAAGCCGATGTACATCTCCAATGGTGTTCTTGGCAAGCTCTACCGATCAGCGA
TGGGTCACATGGAGAAATCAGGAGATTCAGGAGCTCTCTCATCATCCTCAGCACAACCAA
GCCCCACATACGATCCTGACCTCGAGGTCCCTGGCTCTGACGAATTCCTGCAAGCTGCAG
AGGAGTACTACGAGCTGTACGAGGAGAAACTGACCACGCTGATGAACTACTACCGTGCGG
AGCTCGAGGACGAGATCCTGACGGGCAACATCCGGAACAAGATGCTGTACCTGAAGAGGG
ACAACAAGAGGTACTTCGAGATGAAGGACCGGATCGTCGCCGCCGTCGACGCCCTGCACA
GGGAGGCGAGGGGCTGGCTGCTGAGCTCCAGGAAGGAAGAGGACGCGTCGCGGATGGCGT
CGGCGTGGTACCGCGTGACGTACCACCCAGACCGCCGCCGCGGGAAGCGGTTCTGGAGCT
TCCCGTGGATCGCCTGCGACAACCTGCTGGCGATCAAGGCGTCGAGCCAGCTCAGGCGGC
GGCGGCAGAAGGACGATGACTCCACCGCGGTGGTGCAGATGGACTGCAGCGCCTGATGTG
GCAGAGGATTCTCTGACTTTGAGTGACTGACATGTGGGCCTGCTGGATAAGGGATCCATG
GGTCAGTGACAAGTTAGAGGGAAATAAATTAGAGGTTCTCTGACGCGCCGTCCTAAGTGA
ACTTTCAACTGCACAGTTCATTGCTGTGCGCCTGTGCCTGTACGCTGTACAAATCTGGTT
CGACTAATCTTAGCTGAGCTGAACAGCAGAGCTCCGGCTCGCAACTTGGAAGAGGAAAGA
GTTTGATGATGAACACCTACGTAGAGTAAAAGTTCCTCTTCCTAATAAAAGAGTCTTAGT
GCTGATCTACCGGTAAGGTGGAGGCTTCCATTTCTTGTTTTCTGCGAAGGAAAGAAACtt
agggtgtgtttagttcacacaaaaattgaaagtttaattgaaagtgaacgatgtaacgaa
aaagttggaagttcatgtgtgtaggaaagttttaatgtgatgaaaaggttactccctc

CDS

1134 bp

>Os04t0465700-01 RNA-dependent RNA polymerase, eukaryotic-type domain containing protein.
TATTTTTATAATGATGACGGGAAAACAGCCACAGTTGTTGGAAAAGTTGCAATCACAAAA
AATCCGTGTCTCCATCCTGGTGATATCCGAGTACTTGAAGCCATCTATGACCCTGATTTG
GTGGGCATGGTTGATTGTCTTGTCTTCCCTCAAAGAGGAGAAAGGCCTCATCCAAACGAA
TGCTCGGGGGGAGATTTGGACGGCGACCTCTATTTTATTACTTGGGATGACAAACTTATT
CCAGAGAAAGTTGATACACCTATGGACTACACAGCAACAAGGCCGCGCATAATGGATCAT
GTTGTTACACTCGAGGAAATTCAGAAGCACTTTGTTGATTACATGATAAATGACTCGCTT
GGTGCCATCTCAACTGCCCACTTGATTCACGCGGACCGTTCGCCACTGAAAGCTCGGAGT
CCCGAGTGCCTCCAGCTGGCAACTCTGCATTCCATGGCAGTTGACTTCGCCAAGACGGGA
GCTCCAGCTGAAATGCCGCGAACATTGAGGCCGAGGGAGTACCCCGACTTCATGGAACGG
TGGGAGAAGCCGATGTACATCTCCAATGGTGTTCTTGGCAAGCTCTACCGATCAGCGATG
GGTCACATGGAGAAATCAGGAGATTCAGGAGCTCTCTCATCATCCTCAGCACAACCAAGC
CCCACATACGATCCTGACCTCGAGGTCCCTGGCTCTGACGAATTCCTGCAAGCTGCAGAG
GAGTACTACGAGCTGTACGAGGAGAAACTGACCACGCTGATGAACTACTACCGTGCGGAG
CTCGAGGACGAGATCCTGACGGGCAACATCCGGAACAAGATGCTGTACCTGAAGAGGGAC
AACAAGAGGTACTTCGAGATGAAGGACCGGATCGTCGCCGCCGTCGACGCCCTGCACAGG
GAGGCGAGGGGCTGGCTGCTGAGCTCCAGGAAGGAAGAGGACGCGTCGCGGATGGCGTCG
GCGTGGTACCGCGTGACGTACCACCCAGACCGCCGCCGCGGGAAGCGGTTCTGGAGCTTC
CCGTGGATCGCCTGCGACAACCTGCTGGCGATCAAGGCGTCGAGCCAGCTCAGGCGGCGG
CGGCAGAAGGACGATGACTCCACCGCGGTGGTGCAGATGGACTGCAGCGCCTGA

Protein

378 aa

>Os04t0465700-01 RNA-dependent RNA polymerase, eukaryotic-type domain containing protein.
YFYNDDGKTATVVGKVAITKNPCLHPGDIRVLEAIYDPDLVGMVDCLVFPQRGERPHPNE
CSGGDLDGDLYFITWDDKLIPEKVDTPMDYTATRPRIMDHVVTLEEIQKHFVDYMINDSL
GAISTAHLIHADRSPLKARSPECLQLATLHSMAVDFAKTGAPAEMPRTLRPREYPDFMER
WEKPMYISNGVLGKLYRSAMGHMEKSGDSGALSSSSAQPSPTYDPDLEVPGSDEFLQAAE
EYYELYEEKLTTLMNYYRAELEDEILTGNIRNKMLYLKRDNKRYFEMKDRIVAAVDALHR
EARGWLLSSRKEEDASRMASAWYRVTYHPDRRRGKRFWSFPWIACDNLLAIKASSQLRRR
RQKDDDSTAVVQMDCSA*

5'UTR

chr04:23287964..23287965 (+ strand) : 2 bp

CDS

chr04:23287966..23288129 (+ strand) : 164 bp

chr04:23288349..23288499 (+ strand) : 151 bp

chr04:23289200..23290018 (+ strand) : 819 bp

3'UTR

chr04:23290019..23290500 (+ strand) : 482 bp

FASTA

>Os04t0465700-01 class=Sequence position=chr04:23287964..23290500 (+ strand)
CATATTTTTA TAATGATGAC GGGAAAACAG CCACAGTTGT TGGAAAAGTT GCAATCACAA AAAATCCGTG TCTCCATCCT
GGTGATATCC GAGTACTTGA AGCCATCTAT GACCCTGATT TGGTGGGCAT GGTTGATTGT CTTGTCTTCC CTCAAAGAGG
AGAAAGGTTT GTGATACTGA AACTGAATTT ATCTCTTACC TTAATGTTTT TTAAAGTTTG TATTGCTTTG CCCATGGCTT
CAATGGAAGG AAAGGAGTCC ATCACTTCTC TATTGAATTG AATCACCACG TTGTCCAGCA TTATCTTCCT TGCTAGGTTC
CTTTTTTATT GTCAACCTTA TGAATGAATG CTGCCAATGA TTTGCTTGTA TTTGATGTTG ATCAGGCCTC ATCCAAACGA
ATGCTCGGGG GGAGATTTGG ACGGCGACCT CTATTTTATT ACTTGGGATG ACAAACTTAT TCCAGAGAAA GTTGATACAC
CTATGGACTA CACAGCAACA AGGCCGCGCA TAATGGATCA TGTTGTTACA CTCGAGGTAA TGCCTGACTA ATTGTTCCTT
TTCCCCTTTT TGCTAGGCTG TTGTTTCTCA TTTACTGAAG GATTTCTTTT TGTTCTTTAC TAATTCAATC TTGATAGTTG
CAAAATGTCA CCAATTATGG ACTGTAGCAT TATAGTCATA TATATGGGCC TGAGGCACCT TTTAAAAATG TATGCTTGCG
GTTAAGGGCA TGAATAAATG CATTAGGACA ATATGTGCAT ATGTTCCATG AAACATGTGA TGCTAATAAG GTTATGCAAA
CCAGAAAGTA CAAGCTTGGA GTGAGTTTCT AACTCAACTA GTCAACTCAC TCAGGATGGT TTAACAATTA ACAGAAAAAC
TGGTGGTCAT TGATCTAAAA GTAATATATC TACGTGAACA CCAATCATTG AAAAGTTTTG AATAATTTCA AACAAGTATG
CACTGACCAT ACACATTTAA CAATAGTATT TAGAAATTTT GAGAGCTTTA TTCAGAAAAG AAAACAGCAT CCCCAAAAAA
AAGAAAAGGA AACAGCAAAT ACTTGCTTCT GTGAAAAAAG AAAGGCCTCT GGAACATAAA TGGCAAATCT TATTGAGTTT
ATGAGTATAG ACTTTTCAAA GTTGCCTCAT GGGTGAACAA ATGCATATCT CCTCTCAACC ATGGTGTTAT ACTCACCTGA
GTGAAATGTT TTTTAAAAAA ATGTCTGTAA CTGCAGGAAA TTCAGAAGCA CTTTGTTGAT TACATGATAA ATGACTCGCT
TGGTGCCATC TCAACTGCCC ACTTGATTCA CGCGGACCGT TCGCCACTGA AAGCTCGGAG TCCCGAGTGC CTCCAGCTGG
CAACTCTGCA TTCCATGGCA GTTGACTTCG CCAAGACGGG AGCTCCAGCT GAAATGCCGC GAACATTGAG GCCGAGGGAG
TACCCCGACT TCATGGAACG GTGGGAGAAG CCGATGTACA TCTCCAATGG TGTTCTTGGC AAGCTCTACC GATCAGCGAT
GGGTCACATG GAGAAATCAG GAGATTCAGG AGCTCTCTCA TCATCCTCAG CACAACCAAG CCCCACATAC GATCCTGACC
TCGAGGTCCC TGGCTCTGAC GAATTCCTGC AAGCTGCAGA GGAGTACTAC GAGCTGTACG AGGAGAAACT GACCACGCTG
ATGAACTACT ACCGTGCGGA GCTCGAGGAC GAGATCCTGA CGGGCAACAT CCGGAACAAG ATGCTGTACC TGAAGAGGGA
CAACAAGAGG TACTTCGAGA TGAAGGACCG GATCGTCGCC GCCGTCGACG CCCTGCACAG GGAGGCGAGG GGCTGGCTGC
TGAGCTCCAG GAAGGAAGAG GACGCGTCGC GGATGGCGTC GGCGTGGTAC CGCGTGACGT ACCACCCAGA CCGCCGCCGC
GGGAAGCGGT TCTGGAGCTT CCCGTGGATC GCCTGCGACA ACCTGCTGGC GATCAAGGCG TCGAGCCAGC TCAGGCGGCG
GCGGCAGAAG GACGATGACT CCACCGCGGT GGTGCAGATG GACTGCAGCG CCTGATGTGG CAGAGGATTC TCTGACTTTG
AGTGACTGAC ATGTGGGCCT GCTGGATAAG GGATCCATGG GTCAGTGACA AGTTAGAGGG AAATAAATTA GAGGTTCTCT
GACGCGCCGT CCTAAGTGAA CTTTCAACTG CACAGTTCAT TGCTGTGCGC CTGTGCCTGT ACGCTGTACA AATCTGGTTC
GACTAATCTT AGCTGAGCTG AACAGCAGAG CTCCGGCTCG CAACTTGGAA GAGGAAAGAG TTTGATGATG AACACCTACG
TAGAGTAAAA GTTCCTCTTC CTAATAAAAG AGTCTTAGTG CTGATCTACC GGTAAGGTGG AGGCTTCCAT TTCTTGTTTT
CTGCGAAGGA AAGAAACtta gggtgtgttt agttcacaca aaaattgaaa gtttaattga aagtgaacga tgtaacgaaa
aagttggaag ttcatgtgtg taggaaagtt ttaatgtgat gaaaaggtta ctccctc

Locus: Os04g0465700

Loading...

Locus: Os04g0465700

Loading...