Os04t0469800-01

Locus

Os04g0469800

Description

Cytochrome P450 superfamily protein, CYP724B1, Brassinosteroid (BR) biosynthesis, Control of panicle architecture and seed size

RAP-DB Gene Symbol Synonym(s)

D11, d11(d8), dwf10, d8, D11/CYP724B1, d11, CYP724B1

RAP-DB Gene Name Synonym(s)

DWARF SHINKANEAIKOKU OR NOHRIN 28, shinkaneaikoku or nohrin 28 dwarf, DWARF SHINKANEAIKOKU OR NOHRIN 28, OsDWARF11, dwarf-11, Cytochrome P450 724B1, Dwarf protein 11, cytochrome P450 CYP724B1, DWARF11, CLUSTERED PRIMARY BRANCH 1

CGSNL Gene Symbol

D11

CGSNL Gene Name

DWARF SHINKANEAIKOKU OR NOHRIN 28

Oryzabase Gene Symbol Synonym(s)

d11(d8), dwf10, d8, D11/CYP724B1, d11, CYP724B1, GNS4, OsD11, PMM1, OsPMM1, PMM1/D11, NBG4, OsCPB1, CPB1, CPB1/D11

Oryzabase Gene Name Synonym(s)

shinkaneaikoku or nohrin 28 dwarf, DWARF SHINKANEAIKOKU OR NOHRIN 28, OsDWARF11, dwarf-11, Cytochrome P450 724B1, Dwarf protein 11, cytochrome P450 CYP724B1, DWARF11, grain number and size on chromosome 4, Panicle Morphology Mutant 1, Notched Belly Grain 4, CLUSTERED PRIMARY BRANCH 1

Transcript Evidence

AB158759

AK106528

AK119772

Protein Evidence

Q6F4F5

Literature

PMID: 15705958

PMID: 25923523

Note

Manual Curation

February 3, 2016

Gene Ontology (GO)

Biological Process: iron ion transport (GO:0006826)

Biological Process: cellular iron ion homeostasis (GO:0006879)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: ferric iron binding (GO:0008199)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (GO:0016705)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Bacterioferritin (IPR002024)

Cytochrome P450 (IPR001128)

Cytochrome P450, E-class, group I (IPR002401)

Cytochrome P450, conserved site (IPR017972)

Full-length cDNA

002-107-G06 (Online Clone Ordering)

002-172-F03 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0469800-01)

RiceXPro (AK106528)

Others

Oryzabase (608)

KEGG (Os04t0469800-01 (EC:1.14.-.-))

Transcript

2024 bp

>Os04t0469800-01 Cytochrome P450 superfamily protein, CYP724B1, Brassinosteroid (BR) biosynthesis, Control of panicle architecture and seed size
AGAGAAAAATAGAGGGAGGGAGAGGGAGAGAAGCAGAGTGTTGAGCACAAGCTAGTGAAA
GGGTTAGATAGAAACTTGGTAGAATAGACAGATAGGCAGAGAGAGAGAGAGAGCTTAGCA
AGCTAAGGCTTAGCTGCTGCAAGGCTCCATCCATGCTTCTTGTTGTGAGATGAGATTGAG
ATAAGATGAGCAGGGGGTGGTGGTGCCTGGTGTGAGGCTATAGGTAAGATGGTGGGAGGA
GAGCTTGTGCTGGCTGCTCTGGTGATCCTGCTTGCTTTGCTGCTGACCCTGGTGCTGAGC
CACTTCCTGCCTTTGCTCCTGAATCCCAAGGCTCCCAAGGGAAGCTTTGGGTGGCCTCTC
CTTGGTGAGACGCTGAGGTTCCTCAGTCCTCATGCTAGCAACACCCTGGGCAGCTTCCTG
GAGGATCACTGCTCCAGGTATGGGAGGGTGTTTAAGTCCCATCTGTTCTGCACCCCCACC
ATAGTGTCCTGTGACCAGGAGCTGAACCACTTCATCCTTCAGAATGAGGAGAGGCTGTTT
CAGTGCAGCTACCCCAGGCCAATTCATGGCATTCTGGGCAAGTCCTCCATGTTAGTGGTC
CTAGGGGAGGACCACAAGAGGCTCAGGAACCTTGCTCTAGCACTGGTCACCTCCACAAAG
CTCAAGCCCAGCTACCTTGGCGACATTGAGAAGATTGCACTGCATATAGTTGGGTCATGG
CATGGCAAGAGCAAGGACAAGGGGATGGTCAATGTCATCGCCTTCTGCGAGGAGGCAAGA
AAGTTTGCATTCAGTGTAATAGTGAAGCAGGTGCTGGGGCTATCACCAGAGGAGCCGGTC
ACTGCCATGATACTTGAAGATTTCCTCGCCTTCATGAAGGGTCTCATCTCTTTCCCTCTC
TACATCCCAGGGACGCCCTATGCCAAAGCTGTGCAGGCCAGAGCGAGGATATCAAGCACT
GTGAAGGGTATTATTGAGGAGAGGAGGAATGCTGGCTCCAGCAACAAGGGTGATTTCCTT
GATGTGCTGCTTTCAAGCAATGAGCTCTCTGATGAGGAGAAAGTGAGCTTTGTGCTGGAT
TCCTTACTGGGAGGATATGAGACCACCTCACTCTTGATCTCCATGGTTGTGTATTTCCTT
GGGCAGTCAGCTCAAGATCTGGAACTAGTGAAGAGGGAGCATGAAGGCATAAGATCGAAG
AAAGAGAAGGACGAGTTCTTGAGCTCTGAAGACTATAAGAAGATGGAATATACCCAACAT
GTTATCAATGAGGCACTGAGATGTGGCAACATTGTCAAGTTTGTCCACAGGAAGGCTCTC
AAAGATGTCAGATACAAAGAGTATCTGATTCCTTCTGGTTGGAAGGTCCTACCTGTTTTC
AGTGCTGTTCATTTGAACCCCTTACTTCATGGAAATGCCCAACAATTTCAGCCCTGCAGA
TGGGAGGGTGCAAGCCAAGGGACAAGCAAGAAGTTTACGCCGTTCGGCGGTGGCCCCCGG
CTCTGCCCTGGATCAGAGCTTGCAAAAGTAGAGGCTGCTTTCTTCCTCCATCACCTTGTG
CTCAATTATAGATGGAGAATCGATGGCGATGACATTCCGATGGCATACCCGTACGTGGAG
TTCCAGAGAGGTCTGCCCATAGAAATCGAGCCACTTTGCTCTGAATCCTGACAGGTTTGC
AGTTGCAGCCACGGTGAGCGAGTTCATCAAATCATCCCCGCAAGCGAGGGGGAGATGCGG
GCGAGAACGACGGACTGAGAGGATTAGTCAGTGAAACAAAAAAAAGGAGAGAAAATATTT
CAAGAACTGAAGAATGCACTGAGCATTAGCTAGTAGTACCTATCAATGAGCCAAGCTGAG
ATTGTAATTTGCTGTACATGGTGTAGATATATTTTGTCCATGCCGATTGCTTGCGGTGGT
GGTGGTGCGGTGCTTCACCCTGTAACATCCTCCACTGTTTCAACTTTCATCTGCTATTCT
ATAGAAGAAAAAAAAAAGAAGAAAATTGGGCTATTGGGCTATTG

CDS

1443 bp

>Os04t0469800-01 Cytochrome P450 superfamily protein, CYP724B1, Brassinosteroid (BR) biosynthesis, Control of panicle architecture and seed size
ATGGTGGGAGGAGAGCTTGTGCTGGCTGCTCTGGTGATCCTGCTTGCTTTGCTGCTGACC
CTGGTGCTGAGCCACTTCCTGCCTTTGCTCCTGAATCCCAAGGCTCCCAAGGGAAGCTTT
GGGTGGCCTCTCCTTGGTGAGACGCTGAGGTTCCTCAGTCCTCATGCTAGCAACACCCTG
GGCAGCTTCCTGGAGGATCACTGCTCCAGGTATGGGAGGGTGTTTAAGTCCCATCTGTTC
TGCACCCCCACCATAGTGTCCTGTGACCAGGAGCTGAACCACTTCATCCTTCAGAATGAG
GAGAGGCTGTTTCAGTGCAGCTACCCCAGGCCAATTCATGGCATTCTGGGCAAGTCCTCC
ATGTTAGTGGTCCTAGGGGAGGACCACAAGAGGCTCAGGAACCTTGCTCTAGCACTGGTC
ACCTCCACAAAGCTCAAGCCCAGCTACCTTGGCGACATTGAGAAGATTGCACTGCATATA
GTTGGGTCATGGCATGGCAAGAGCAAGGACAAGGGGATGGTCAATGTCATCGCCTTCTGC
GAGGAGGCAAGAAAGTTTGCATTCAGTGTAATAGTGAAGCAGGTGCTGGGGCTATCACCA
GAGGAGCCGGTCACTGCCATGATACTTGAAGATTTCCTCGCCTTCATGAAGGGTCTCATC
TCTTTCCCTCTCTACATCCCAGGGACGCCCTATGCCAAAGCTGTGCAGGCCAGAGCGAGG
ATATCAAGCACTGTGAAGGGTATTATTGAGGAGAGGAGGAATGCTGGCTCCAGCAACAAG
GGTGATTTCCTTGATGTGCTGCTTTCAAGCAATGAGCTCTCTGATGAGGAGAAAGTGAGC
TTTGTGCTGGATTCCTTACTGGGAGGATATGAGACCACCTCACTCTTGATCTCCATGGTT
GTGTATTTCCTTGGGCAGTCAGCTCAAGATCTGGAACTAGTGAAGAGGGAGCATGAAGGC
ATAAGATCGAAGAAAGAGAAGGACGAGTTCTTGAGCTCTGAAGACTATAAGAAGATGGAA
TATACCCAACATGTTATCAATGAGGCACTGAGATGTGGCAACATTGTCAAGTTTGTCCAC
AGGAAGGCTCTCAAAGATGTCAGATACAAAGAGTATCTGATTCCTTCTGGTTGGAAGGTC
CTACCTGTTTTCAGTGCTGTTCATTTGAACCCCTTACTTCATGGAAATGCCCAACAATTT
CAGCCCTGCAGATGGGAGGGTGCAAGCCAAGGGACAAGCAAGAAGTTTACGCCGTTCGGC
GGTGGCCCCCGGCTCTGCCCTGGATCAGAGCTTGCAAAAGTAGAGGCTGCTTTCTTCCTC
CATCACCTTGTGCTCAATTATAGATGGAGAATCGATGGCGATGACATTCCGATGGCATAC
CCGTACGTGGAGTTCCAGAGAGGTCTGCCCATAGAAATCGAGCCACTTTGCTCTGAATCC
TGA

Protein

480 aa

>Os04t0469800-01 Cytochrome P450 superfamily protein, CYP724B1, Brassinosteroid (BR) biosynthesis, Control of panicle architecture and seed size
MVGGELVLAALVILLALLLTLVLSHFLPLLLNPKAPKGSFGWPLLGETLRFLSPHASNTL
GSFLEDHCSRYGRVFKSHLFCTPTIVSCDQELNHFILQNEERLFQCSYPRPIHGILGKSS
MLVVLGEDHKRLRNLALALVTSTKLKPSYLGDIEKIALHIVGSWHGKSKDKGMVNVIAFC
EEARKFAFSVIVKQVLGLSPEEPVTAMILEDFLAFMKGLISFPLYIPGTPYAKAVQARAR
ISSTVKGIIEERRNAGSSNKGDFLDVLLSSNELSDEEKVSFVLDSLLGGYETTSLLISMV
VYFLGQSAQDLELVKREHEGIRSKKEKDEFLSSEDYKKMEYTQHVINEALRCGNIVKFVH
RKALKDVRYKEYLIPSGWKVLPVFSAVHLNPLLHGNAQQFQPCRWEGASQGTSKKFTPFG
GGPRLCPGSELAKVEAAFFLHHLVLNYRWRIDGDDIPMAYPYVEFQRGLPIEIEPLCSES
*

5'UTR

chr04:23471365..23471592 (- strand) : 228 bp

CDS

chr04:23471156..23471364 (- strand) : 209 bp

chr04:23470453..23470798 (- strand) : 346 bp

chr04:23470069..23470223 (- strand) : 155 bp

chr04:23469715..23469949 (- strand) : 235 bp

chr04:23469526..23469612 (- strand) : 87 bp

chr04:23469158..23469236 (- strand) : 79 bp

chr04:23468865..23468971 (- strand) : 107 bp

chr04:23468283..23468407 (- strand) : 125 bp

chr04:23467520..23467619 (- strand) : 100 bp

3'UTR

chr04:23467167..23467519 (- strand) : 353 bp

FASTA

>Os04t0469800-01 class=Sequence position=chr04:23467167..23471592 (- strand)
AGAGAAAAAT AGAGGGAGGG AGAGGGAGAG AAGCAGAGTG TTGAGCACAA GCTAGTGAAA GGGTTAGATA GAAACTTGGT
AGAATAGACA GATAGGCAGA GAGAGAGAGA GAGCTTAGCA AGCTAAGGCT TAGCTGCTGC AAGGCTCCAT CCATGCTTCT
TGTTGTGAGA TGAGATTGAG ATAAGATGAG CAGGGGGTGG TGGTGCCTGG TGTGAGGCTA TAGGTAAGAT GGTGGGAGGA
GAGCTTGTGC TGGCTGCTCT GGTGATCCTG CTTGCTTTGC TGCTGACCCT GGTGCTGAGC CACTTCCTGC CTTTGCTCCT
GAATCCCAAG GCTCCCAAGG GAAGCTTTGG GTGGCCTCTC CTTGGTGAGA CGCTGAGGTT CCTCAGTCCT CATGCTAGCA
ACACCCTGGG CAGCTTCCTG GAGGATCACT GCTCCAGGTA AATTAAAATC ATATGCAGTA AACATTTCTA TCAGTATCAC
CACCACAACC ACACAGGAGC AACAAGTGTC ATCTTACCAT GCAATTAAGT ACTGTACCAT TATTTCATGT GACAGCACAA
GGTAATGCTG CTGTCCTGTC CCAGCAGCTT TATCACGCCC TTTTTTTTCC TCCCTGATGA GGGGGGTGCT GTAACATGAA
TTGGACAGTG TTTAGCATCT TGTTAAAGAG TTGTGCAAAC CTTTTCTTCC GATGAACAAG CGAGAGAAAA GGAATGTAAA
GGTTGCACAA CACTTAACTA GCTAGCATGC ATGGTGGTAG TAACACTGAT GATGGTGTGA TGATGATGAT GCAGGTATGG
GAGGGTGTTT AAGTCCCATC TGTTCTGCAC CCCCACCATA GTGTCCTGTG ACCAGGAGCT GAACCACTTC ATCCTTCAGA
ATGAGGAGAG GCTGTTTCAG TGCAGCTACC CCAGGCCAAT TCATGGCATT CTGGGCAAGT CCTCCATGTT AGTGGTCCTA
GGGGAGGACC ACAAGAGGCT CAGGAACCTT GCTCTAGCAC TGGTCACCTC CACAAAGCTC AAGCCCAGCT ACCTTGGCGA
CATTGAGAAG ATTGCACTGC ATATAGTTGG GTCATGGCAT GGCAAGAGCA AGGACAAGGG GATGGTCAAT GTCATCGCCT
TCTGCGAGGA GGCAAGAAAG GTTAGCAAGT GTACTAACTT GAAACCAGAG CCATATCACC ACAAGGACAT GATCCCTTGA
AACAAGGGAG GGAAAACTTT GCACATGTTA GCTACATACC ATCATCATCA TGTTGTTACT TGCTGCTGCA TGAATCTTTG
TCCCAAGGTC ACTTTGACTT ACCATGGTCT TTTTTACCTT TTCTTTTTTT TTCTCTCTCT GGTGTGCTCT CTTTCCTTGA
GAACCACAGT TTGCATTCAG TGTAATAGTG AAGCAGGTGC TGGGGCTATC ACCAGAGGAG CCGGTCACTG CCATGATACT
TGAAGATTTC CTCGCCTTCA TGAAGGGTCT CATCTCTTTC CCTCTCTACA TCCCAGGGAC GCCCTATGCC AAAGCTGTGC
AGGCATGCAA CTCAACATCT CATTTACACA AGTCGTTAAA CTGTCAATAA AATTTTCAGG CCATTTTATT TTTGTATACT
TACCATAATA ACTTCATCCT TTTGTCCGCG AATCCTCACA GGCCAGAGCG AGGATATCAA GCACTGTGAA GGGTATTATT
GAGGAGAGGA GGAATGCTGG CTCCAGCAAC AAGGGTGATT TCCTTGATGT GCTGCTTTCA AGCAATGAGC TCTCTGATGA
GGAGAAAGTG AGCTTTGTGC TGGATTCCTT ACTGGGAGGA TATGAGACCA CCTCACTCTT GATCTCCATG GTTGTGTATT
TCCTTGGGCA GTCAGCTCAA GATCTGGAAC TAGTGAAGGT ATACAGACTT CTCATGCTGA AAAAGACAGA GCAGTACTGG
TAAATAAGTA CTTAATTAAG TGGCCATCAA TAAAATATAT ATTAACATGT TTGCATGCAG AGGGAGCATG AAGGCATAAG
ATCGAAGAAA GAGAAGGACG AGTTCTTGAG CTCTGAAGAC TATAAGAAGA TGGAATATAC CCAACATGTA AGATGATCGT
TCAATACATG CTTTAGGATT AGTTAGTAAG CCAGGGGTAC CTTTTTTTCC TATTATCAGC AACTACACAA ATATGTGACC
CTCCGAATAT GAGGTTTACT CATATTCAGA ACGATTCTCC TATGCCTACC CATATATGCA ATTTTTGAAT TAAGCAAAAA
AAAGAAAAAG AAACAGAGAG AGAAAGAATC TCATTACAAT AGAGTGAAAA GGGCGGAAGG GACATGTTCT TCAATAATGG
AAACTGTATG ATGATGCATA TGCTATGCCC TTACAGGTTA TCAATGAGGC ACTGAGATGT GGCAACATTG TCAAGTTTGT
CCACAGGAAG GCTCTCAAAG ATGTCAGATA CAAAGGTAAT TAACCCTACT TGAGGCTTTC CTTGAAGATT CCATTGTGCT
CATCACATGA TAATGGATCA GGCAAAGTGG ATGGTTGCAC CTTTATTACT GATTTTTAAG CATTGTTATT CCTAAAATAC
CTCAGCTTTT CATAGAAGAT GCTCAAAAGC AAGTGGCTCT TTTTTCTTTG CTCTGTTGCA GAGTATCTGA TTCCTTCTGG
TTGGAAGGTC CTACCTGTTT TCAGTGCTGT TCATTTGAAC CCCTTACTTC ATGGAAATGC CCAACAATTT CAGCCCTGCA
GATGGGAGGT ACGTTTGTTT CCATAATCTG TGAATGCTCC GCAATACTTA CTAAATGTTT ATTGTTAATG ACCTAATGAA
AAATGTTTTG GACCAGCTAG GCCACGAAGC TTAGCTTTCA CGTAGTATAC TTTTCTATAA TACAAATTTA TAAAATGAAA
AGTTCAGAGC ACCTATCAAG AGAGCTTATC TGGAGCCTTG AAAGAATCTT CTTTAAAGGG TGTTCTCTAA CTAATTGCTA
CCTTTAATTA GTGAGCGCCC AACTATGACA TAATTACTCG CAACTATTCT GGTGTCTTCA GATGCCAAAC AAGCTCCCTG
TGGCTGCAAT GCCTTTTGTG CATGGTCCTA ACCATGATTC CTCTCATTCA AAGCCAGCAT TCTTGGCTTT GCTTCCTTTT
CTTAGTTTCT GTGATGAAGC TAATGGTCTG ATTCATGTGT GTTCCTAATC TGATTGATGC AACAGGGTGC AAGCCAAGGG
ACAAGCAAGA AGTTTACGCC GTTCGGCGGT GGCCCCCGGC TCTGCCCTGG ATCAGAGCTT GCAAAAGTAG AGGCTGCTTT
CTTCCTCCAT CACCTTGTGC TCAATTATAG GTAAAACAAA AGGGTATATT TGTCCTACCC GAGTAGAAGA TGCATGGATC
AAAGTTGACT GGCTTAAACA GCAATGAACA AAATACGTTC AGAAGTAATA TTTAAGAAGC TGGTGCAGAG TAGTTGGTGT
TTAAATAGGC CATAGAAAAC TGTTGAGGCA AACATGAACA GGAAAACATA CTGATGCAGT TACCACTCTC ATACTGATAA
TACACACTAC ACTAGACCAC TAGTAAGTAA TGGCAAGAAG GCCATGACAG CAACTAGGCA AATTATTTAT GCTTTTGTCT
GTAAGGACCG CAAGTCTGAA CTCAGCTATC TTGTGCATTT TCATAAGTGG CACTGTAGAG CATAGAATCA GACGACAACA
CACAGAACAA ACATGACAGC ATGGAGTTTT CGATAGGTAG GCTATGCAAG TTGAGTTGAG GGCTGCCATA CAAGATAAAA
TATACTACCA CGATATGATC AAACTCTTTT TTTTAAAAAA AAAACTAGGT TCATTAGCAA CAATCTATAC GTGACAACTG
ACAAGAACAG GCAGATTTAT GTAAATTATG CGGTTGTTTC AGAGTAGAGT CTACATGTAC TTACTGAATA TCCATGCCAG
AGAAAGGCTG ATCATCGTTC TTCGTTTCTT TCGTTTCTTG AAAACCTGTG CAGATGGAGA ATCGATGGCG ATGACATTCC
GATGGCATAC CCGTACGTGG AGTTCCAGAG AGGTCTGCCC ATAGAAATCG AGCCACTTTG CTCTGAATCC TGACAGGTTT
GCAGTTGCAG CCACGGTGAG CGAGTTCATC AAATCATCCC CGCAAGCGAG GGGGAGATGC GGGCGAGAAC GACGGACTGA
GAGGATTAGT CAGTGAAACA AAAAAAAGGA GAGAAAATAT TTCAAGAACT GAAGAATGCA CTGAGCATTA GCTAGTAGTA
CCTATCAATG AGCCAAGCTG AGATTGTAAT TTGCTGTACA TGGTGTAGAT ATATTTTGTC CATGCCGATT GCTTGCGGTG
GTGGTGGTGC GGTGCTTCAC CCTGTAACAT CCTCCACTGT TTCAACTTTC ATCTGCTATT CTATAGAAGA AAAAAAAAAG
AAGAAAATTG GGCTATTGGG CTATTG

Locus: Os04g0469800

Loading...

Locus: Os04g0469800

Loading...