Os04t0469800-02

Locus

Os04g0469800

Description

Similar to OSIGBa0124N08.3 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

D11

CGSNL Gene Name

DWARF SHINKANEAIKOKU OR NOHRIN 28

Oryzabase Gene Symbol Synonym(s)

d11(d8), dwf10, d8, D11/CYP724B1, d11, CYP724B1, GNS4, OsD11, PMM1, OsPMM1, PMM1/D11, NBG4, OsCPB1, CPB1, CPB1/D11

Oryzabase Gene Name Synonym(s)

shinkaneaikoku or nohrin 28 dwarf, DWARF SHINKANEAIKOKU OR NOHRIN 28, OsDWARF11, dwarf-11, Cytochrome P450 724B1, Dwarf protein 11, cytochrome P450 CYP724B1, DWARF11, grain number and size on chromosome 4, Panicle Morphology Mutant 1, Notched Belly Grain 4, CLUSTERED PRIMARY BRANCH 1

Transcript Evidence

AK101419 (DDBJ, Best hit)

Protein Evidence

Q01JN4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: iron ion transport (GO:0006826)

Biological Process: cellular iron ion homeostasis (GO:0006879)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: ferric iron binding (GO:0008199)

Molecular Function: electron carrier activity (GO:0009055)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (GO:0016705)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Cytochrome P450 (IPR001128)

Bacterioferritin (IPR002024)

Full-length cDNA

J033038A11 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0469800-02)

RiceXPro (AK101419)

Others

Oryzabase (608)

KEGG (Os04t0469800-02 (EC:1.14.-.-))

Transcript

2275 bp

>Os04t0469800-02 Similar to OSIGBa0124N08.3 protein.
GAGAAAAATAGAGGGAGGGAGAGGGAGAGAAGCAGAGTGTTGAGCACAAGCTAGTGAAAG
GGTTAGATAGAAACTTGGTAGAATAGACAGATAGGCAGAGAGAGAGAGAGAGCTTAGCAA
GCTAAGGCTTAGCTGCTGCAAGGCTCCATCCATGCTTCTTGTTGTGAGATGAGATTGAGA
TAAGATGAGCAGGGGGTGGTGGTGCCTGGTGTGAGGCTATAGGTAAGATGGTGGGAGGAG
AGCTTGTGCTGGCTGCTCTGGTGATCCTGCTTGCTTTGCTGCTGACCCTGGTGCTGAGCC
ACTTCCTGCCTTTGCTCCTGAATCCCAAGGCTCCCAAGGGAAGCTTTGGGTGGCCTCTCC
TTGGTGAGACGCTGAGGTTCCTCAGTCCTCATGCTAGCAACACCCTGGGCAGCTTCCTGG
AGGATCACTGCTCCAGGTATGGGAGGGTGTTTAAGTCCCATCTGTTCTGCACCCCCACCA
TAGTGTCCTGTGACCAGGAGCTGAACCACTTCATCCTTCAGAATGAGGAGAGGCTGTTTC
AGTGCAGCTACCCCAGGCCAATTCATGGCATTCTGGGCAAGTCCTCCATGTTAGTGGTCC
TAGGGGAGGACCACAAGAGGCTCAGGAACCTTGCTCTAGCACTGGTCACCTCCACAAAGC
TCAAGCCCAGCTACCTTGGCGACATTGAGAAGATTGCACTGCATATAGTTGGGTCATGGC
ATGGCAAGAGCAAGGACAAGGGGATGGTCAATGTCATCGCCTTCTGCGAGGAGGCAAGAA
AGTTTGCATTCAGTGTAATAGTGAAGCAGGTGCTGGGGCTATCACCAGAGGAGCCGGTCA
CTGCCATGATACTTGAAGATTTCCTCGCCTTCATGAAGGGTCTCATCTCTTTCCCTCTCT
ACATCCCAGGGACGCCCTATGCCAAAGCTGTGCAGGCCAGAGCGAGGATATCAAGCACTG
TGAAGGGTATTATTGAGGAGAGGAGGAATGCTGGCTCCAGCAACAAGGGTGATTTCCTTG
ATGTGCTGCTTTCAAGCAATGAGCTCTCTGATGAGGAGAAAGTGAGCTTTGTGCTGGATT
CCTTACTGGGAGGATATGAGACCACCTCACTCTTGATCTCCATGGTTGTGTATTTCCTTG
GGCAGTCAGCTCAAGATCTGGAACTAGTGAAGAGGGAGCATGAAGGCATAAGATCGAAGA
AAGAGAAGGACGAGTTCTTGAGCTCTGAAGACTATAAGAAGATGGAATATACCCAACATG
TAAGATGATCGTTCAATACATGCTTTAGGATTAGTTAGTAAGCCAGGGGTACCTTTTTTT
CCTATTATCAGCAACTACACAAATATGTGACCCTCCGAATATGAGGTTTACTCATATTCA
GAACGATTCTCCTATGCCTACCCATATATGCAATTTTTGAATTAAGCAAAAAAAAGAAAA
AGAAACAGAGAGAGAAAGAATCTCATTACAATAGAGTGAAAAGGGCGGAAGGGACATGTT
CTTCAATAATGGAAACTGTATGATGATGCATATGCTATGCCCTTACAGGTTATCAATGAG
GCACTGAGATGTGGCAACATTGTCAAGTTTGTCCACAGGAAGGCTCTCAAAGATGTCAGA
TACAAAGAGTATCTGATTCCTTCTGGTTGGAAGGTCCTACCTGTTTTCAGTGCTGTTCAT
TTGAACCCCTTACTTCATGGAAATGCCCAACAATTTCAGCCCTGCAGATGGGAGGGTGCA
AGCCAAGGGACAAGCAAGAAGTTTACGCCGTTCGGCGGTGGCCCCCGGCTCTGCCCTGGA
TCAGAGCTTGCAAAAGTAGAGGCTGCTTTCTTCCTCCATCACCTTGTGCTCAATTATAGA
TGGAGAATCGATGGCGATGACATTCCGATGGCATACCCGTACGTGGAGTTCCAGAGAGGT
CTGCCCATAGAAATCGAGCCACTTTGCTCTGAATCCTGACAGGTTTGCAGTTGCAGCCAC
GGTGAGCGAGTTCATCAAATCATCCCCGCAAGCGAGGGGGAGATGCGGGCGAGAACGACG
GACTGAGAGGATTAGTCAGTGAAACAAAAAAAAGGAGAGAAAATATTTCAAGAACTGAAG
AATGCACTGAGCATTAGCTAGTAGTACCTATCAATGAGCCAAGCTGAGATTGTAATTTGC
TGTACATGGTGTAGATATATTTTGTCCATGCCGATTGCTTGCGGTGGTGGTGGTGCGGTG
CTTCACCCTGTAACATCCTCCACTGTTTCAACTTTCATCTGCTATTCTATAGAAG

CDS

1041 bp

>Os04t0469800-02 Similar to OSIGBa0124N08.3 protein.
ATGGTGGGAGGAGAGCTTGTGCTGGCTGCTCTGGTGATCCTGCTTGCTTTGCTGCTGACC
CTGGTGCTGAGCCACTTCCTGCCTTTGCTCCTGAATCCCAAGGCTCCCAAGGGAAGCTTT
GGGTGGCCTCTCCTTGGTGAGACGCTGAGGTTCCTCAGTCCTCATGCTAGCAACACCCTG
GGCAGCTTCCTGGAGGATCACTGCTCCAGGTATGGGAGGGTGTTTAAGTCCCATCTGTTC
TGCACCCCCACCATAGTGTCCTGTGACCAGGAGCTGAACCACTTCATCCTTCAGAATGAG
GAGAGGCTGTTTCAGTGCAGCTACCCCAGGCCAATTCATGGCATTCTGGGCAAGTCCTCC
ATGTTAGTGGTCCTAGGGGAGGACCACAAGAGGCTCAGGAACCTTGCTCTAGCACTGGTC
ACCTCCACAAAGCTCAAGCCCAGCTACCTTGGCGACATTGAGAAGATTGCACTGCATATA
GTTGGGTCATGGCATGGCAAGAGCAAGGACAAGGGGATGGTCAATGTCATCGCCTTCTGC
GAGGAGGCAAGAAAGTTTGCATTCAGTGTAATAGTGAAGCAGGTGCTGGGGCTATCACCA
GAGGAGCCGGTCACTGCCATGATACTTGAAGATTTCCTCGCCTTCATGAAGGGTCTCATC
TCTTTCCCTCTCTACATCCCAGGGACGCCCTATGCCAAAGCTGTGCAGGCCAGAGCGAGG
ATATCAAGCACTGTGAAGGGTATTATTGAGGAGAGGAGGAATGCTGGCTCCAGCAACAAG
GGTGATTTCCTTGATGTGCTGCTTTCAAGCAATGAGCTCTCTGATGAGGAGAAAGTGAGC
TTTGTGCTGGATTCCTTACTGGGAGGATATGAGACCACCTCACTCTTGATCTCCATGGTT
GTGTATTTCCTTGGGCAGTCAGCTCAAGATCTGGAACTAGTGAAGAGGGAGCATGAAGGC
ATAAGATCGAAGAAAGAGAAGGACGAGTTCTTGAGCTCTGAAGACTATAAGAAGATGGAA
TATACCCAACATGTAAGATGA

Protein

346 aa

>Os04t0469800-02 Similar to OSIGBa0124N08.3 protein.
MVGGELVLAALVILLALLLTLVLSHFLPLLLNPKAPKGSFGWPLLGETLRFLSPHASNTL
GSFLEDHCSRYGRVFKSHLFCTPTIVSCDQELNHFILQNEERLFQCSYPRPIHGILGKSS
MLVVLGEDHKRLRNLALALVTSTKLKPSYLGDIEKIALHIVGSWHGKSKDKGMVNVIAFC
EEARKFAFSVIVKQVLGLSPEEPVTAMILEDFLAFMKGLISFPLYIPGTPYAKAVQARAR
ISSTVKGIIEERRNAGSSNKGDFLDVLLSSNELSDEEKVSFVLDSLLGGYETTSLLISMV
VYFLGQSAQDLELVKREHEGIRSKKEKDEFLSSEDYKKMEYTQHVR*

5'UTR

chr04:23471365..23471591 (- strand) : 227 bp

CDS

chr04:23471156..23471364 (- strand) : 209 bp

chr04:23470453..23470798 (- strand) : 346 bp

chr04:23470069..23470223 (- strand) : 155 bp

chr04:23469715..23469949 (- strand) : 235 bp

chr04:23469517..23469612 (- strand) : 96 bp

3'UTR

chr04:23469158..23469516 (- strand) : 359 bp

chr04:23468865..23468971 (- strand) : 107 bp

chr04:23468283..23468407 (- strand) : 125 bp

chr04:23467204..23467619 (- strand) : 416 bp

FASTA

>Os04t0469800-02 class=Sequence position=chr04:23467204..23471591 (- strand)
GAGAAAAATA GAGGGAGGGA GAGGGAGAGA AGCAGAGTGT TGAGCACAAG CTAGTGAAAG GGTTAGATAG AAACTTGGTA
GAATAGACAG ATAGGCAGAG AGAGAGAGAG AGCTTAGCAA GCTAAGGCTT AGCTGCTGCA AGGCTCCATC CATGCTTCTT
GTTGTGAGAT GAGATTGAGA TAAGATGAGC AGGGGGTGGT GGTGCCTGGT GTGAGGCTAT AGGTAAGATG GTGGGAGGAG
AGCTTGTGCT GGCTGCTCTG GTGATCCTGC TTGCTTTGCT GCTGACCCTG GTGCTGAGCC ACTTCCTGCC TTTGCTCCTG
AATCCCAAGG CTCCCAAGGG AAGCTTTGGG TGGCCTCTCC TTGGTGAGAC GCTGAGGTTC CTCAGTCCTC ATGCTAGCAA
CACCCTGGGC AGCTTCCTGG AGGATCACTG CTCCAGGTAA ATTAAAATCA TATGCAGTAA ACATTTCTAT CAGTATCACC
ACCACAACCA CACAGGAGCA ACAAGTGTCA TCTTACCATG CAATTAAGTA CTGTACCATT ATTTCATGTG ACAGCACAAG
GTAATGCTGC TGTCCTGTCC CAGCAGCTTT ATCACGCCCT TTTTTTTCCT CCCTGATGAG GGGGGTGCTG TAACATGAAT
TGGACAGTGT TTAGCATCTT GTTAAAGAGT TGTGCAAACC TTTTCTTCCG ATGAACAAGC GAGAGAAAAG GAATGTAAAG
GTTGCACAAC ACTTAACTAG CTAGCATGCA TGGTGGTAGT AACACTGATG ATGGTGTGAT GATGATGATG CAGGTATGGG
AGGGTGTTTA AGTCCCATCT GTTCTGCACC CCCACCATAG TGTCCTGTGA CCAGGAGCTG AACCACTTCA TCCTTCAGAA
TGAGGAGAGG CTGTTTCAGT GCAGCTACCC CAGGCCAATT CATGGCATTC TGGGCAAGTC CTCCATGTTA GTGGTCCTAG
GGGAGGACCA CAAGAGGCTC AGGAACCTTG CTCTAGCACT GGTCACCTCC ACAAAGCTCA AGCCCAGCTA CCTTGGCGAC
ATTGAGAAGA TTGCACTGCA TATAGTTGGG TCATGGCATG GCAAGAGCAA GGACAAGGGG ATGGTCAATG TCATCGCCTT
CTGCGAGGAG GCAAGAAAGG TTAGCAAGTG TACTAACTTG AAACCAGAGC CATATCACCA CAAGGACATG ATCCCTTGAA
ACAAGGGAGG GAAAACTTTG CACATGTTAG CTACATACCA TCATCATCAT GTTGTTACTT GCTGCTGCAT GAATCTTTGT
CCCAAGGTCA CTTTGACTTA CCATGGTCTT TTTTACCTTT TCTTTTTTTT TCTCTCTCTG GTGTGCTCTC TTTCCTTGAG
AACCACAGTT TGCATTCAGT GTAATAGTGA AGCAGGTGCT GGGGCTATCA CCAGAGGAGC CGGTCACTGC CATGATACTT
GAAGATTTCC TCGCCTTCAT GAAGGGTCTC ATCTCTTTCC CTCTCTACAT CCCAGGGACG CCCTATGCCA AAGCTGTGCA
GGCATGCAAC TCAACATCTC ATTTACACAA GTCGTTAAAC TGTCAATAAA ATTTTCAGGC CATTTTATTT TTGTATACTT
ACCATAATAA CTTCATCCTT TTGTCCGCGA ATCCTCACAG GCCAGAGCGA GGATATCAAG CACTGTGAAG GGTATTATTG
AGGAGAGGAG GAATGCTGGC TCCAGCAACA AGGGTGATTT CCTTGATGTG CTGCTTTCAA GCAATGAGCT CTCTGATGAG
GAGAAAGTGA GCTTTGTGCT GGATTCCTTA CTGGGAGGAT ATGAGACCAC CTCACTCTTG ATCTCCATGG TTGTGTATTT
CCTTGGGCAG TCAGCTCAAG ATCTGGAACT AGTGAAGGTA TACAGACTTC TCATGCTGAA AAAGACAGAG CAGTACTGGT
AAATAAGTAC TTAATTAAGT GGCCATCAAT AAAATATATA TTAACATGTT TGCATGCAGA GGGAGCATGA AGGCATAAGA
TCGAAGAAAG AGAAGGACGA GTTCTTGAGC TCTGAAGACT ATAAGAAGAT GGAATATACC CAACATGTAA GATGATCGTT
CAATACATGC TTTAGGATTA GTTAGTAAGC CAGGGGTACC TTTTTTTCCT ATTATCAGCA ACTACACAAA TATGTGACCC
TCCGAATATG AGGTTTACTC ATATTCAGAA CGATTCTCCT ATGCCTACCC ATATATGCAA TTTTTGAATT AAGCAAAAAA
AAGAAAAAGA AACAGAGAGA GAAAGAATCT CATTACAATA GAGTGAAAAG GGCGGAAGGG ACATGTTCTT CAATAATGGA
AACTGTATGA TGATGCATAT GCTATGCCCT TACAGGTTAT CAATGAGGCA CTGAGATGTG GCAACATTGT CAAGTTTGTC
CACAGGAAGG CTCTCAAAGA TGTCAGATAC AAAGGTAATT AACCCTACTT GAGGCTTTCC TTGAAGATTC CATTGTGCTC
ATCACATGAT AATGGATCAG GCAAAGTGGA TGGTTGCACC TTTATTACTG ATTTTTAAGC ATTGTTATTC CTAAAATACC
TCAGCTTTTC ATAGAAGATG CTCAAAAGCA AGTGGCTCTT TTTTCTTTGC TCTGTTGCAG AGTATCTGAT TCCTTCTGGT
TGGAAGGTCC TACCTGTTTT CAGTGCTGTT CATTTGAACC CCTTACTTCA TGGAAATGCC CAACAATTTC AGCCCTGCAG
ATGGGAGGTA CGTTTGTTTC CATAATCTGT GAATGCTCCG CAATACTTAC TAAATGTTTA TTGTTAATGA CCTAATGAAA
AATGTTTTGG ACCAGCTAGG CCACGAAGCT TAGCTTTCAC GTAGTATACT TTTCTATAAT ACAAATTTAT AAAATGAAAA
GTTCAGAGCA CCTATCAAGA GAGCTTATCT GGAGCCTTGA AAGAATCTTC TTTAAAGGGT GTTCTCTAAC TAATTGCTAC
CTTTAATTAG TGAGCGCCCA ACTATGACAT AATTACTCGC AACTATTCTG GTGTCTTCAG ATGCCAAACA AGCTCCCTGT
GGCTGCAATG CCTTTTGTGC ATGGTCCTAA CCATGATTCC TCTCATTCAA AGCCAGCATT CTTGGCTTTG CTTCCTTTTC
TTAGTTTCTG TGATGAAGCT AATGGTCTGA TTCATGTGTG TTCCTAATCT GATTGATGCA ACAGGGTGCA AGCCAAGGGA
CAAGCAAGAA GTTTACGCCG TTCGGCGGTG GCCCCCGGCT CTGCCCTGGA TCAGAGCTTG CAAAAGTAGA GGCTGCTTTC
TTCCTCCATC ACCTTGTGCT CAATTATAGG TAAAACAAAA GGGTATATTT GTCCTACCCG AGTAGAAGAT GCATGGATCA
AAGTTGACTG GCTTAAACAG CAATGAACAA AATACGTTCA GAAGTAATAT TTAAGAAGCT GGTGCAGAGT AGTTGGTGTT
TAAATAGGCC ATAGAAAACT GTTGAGGCAA ACATGAACAG GAAAACATAC TGATGCAGTT ACCACTCTCA TACTGATAAT
ACACACTACA CTAGACCACT AGTAAGTAAT GGCAAGAAGG CCATGACAGC AACTAGGCAA ATTATTTATG CTTTTGTCTG
TAAGGACCGC AAGTCTGAAC TCAGCTATCT TGTGCATTTT CATAAGTGGC ACTGTAGAGC ATAGAATCAG ACGACAACAC
ACAGAACAAA CATGACAGCA TGGAGTTTTC GATAGGTAGG CTATGCAAGT TGAGTTGAGG GCTGCCATAC AAGATAAAAT
ATACTACCAC GATATGATCA AACTCTTTTT TTTAAAAAAA AAACTAGGTT CATTAGCAAC AATCTATACG TGACAACTGA
CAAGAACAGG CAGATTTATG TAAATTATGC GGTTGTTTCA GAGTAGAGTC TACATGTACT TACTGAATAT CCATGCCAGA
GAAAGGCTGA TCATCGTTCT TCGTTTCTTT CGTTTCTTGA AAACCTGTGC AGATGGAGAA TCGATGGCGA TGACATTCCG
ATGGCATACC CGTACGTGGA GTTCCAGAGA GGTCTGCCCA TAGAAATCGA GCCACTTTGC TCTGAATCCT GACAGGTTTG
CAGTTGCAGC CACGGTGAGC GAGTTCATCA AATCATCCCC GCAAGCGAGG GGGAGATGCG GGCGAGAACG ACGGACTGAG
AGGATTAGTC AGTGAAACAA AAAAAAGGAG AGAAAATATT TCAAGAACTG AAGAATGCAC TGAGCATTAG CTAGTAGTAC
CTATCAATGA GCCAAGCTGA GATTGTAATT TGCTGTACAT GGTGTAGATA TATTTTGTCC ATGCCGATTG CTTGCGGTGG
TGGTGGTGCG GTGCTTCACC CTGTAACATC CTCCACTGTT TCAACTTTCA TCTGCTATTC TATAGAAG

Locus: Os04g0469800

Loading...

Locus: Os04g0469800

Loading...