Os04t0474900-01

Locus

Os04g0474900

Description

β-glucosidase

RAP-DB Gene Symbol Synonym(s)

OsTAGG1, Os4BGlu13

RAP-DB Gene Name Synonym(s)

beta-glucosidase 13, tuberonic acid glucoside beta-glucosidase 1

CGSNL Gene Symbol

BGLU13

CGSNL Gene Name

BETA-GLUCOSIDASE 13

Oryzabase Gene Symbol Synonym(s)

OsTAGG1, TAGG1, Os4BGlu13, 4BGlu13

Oryzabase Gene Name Synonym(s)

beta-glucosidase 13, tuberonic acid glucoside beta-glucosidase 1, tuberonic acid glucoside hydrolyzing beta-glucosidase 1

Transcript Evidence

AK070962

Protein Evidence

Q7XKV2

Literature

PMID: 26241499

PMID: 23649259

Note

Manual Curation

July 29, 2020

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Functional domain (InterPro)

Glycoside hydrolase superfamily (IPR017853)

Glycoside hydrolase family 1 (IPR001360)

Glycosyl hydrolases family 1, N-terminal conserved site (IPR033132)

Full-length cDNA

J023066D17 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0474900-01)

RiceXPro (AK070962)

Others

Oryzabase (8908)

KEGG (Os04t0474900-01 (EC:3.2.1.21))

Transcript

1851 bp

>Os04t0474900-01 β-glucosidase
GGGTCACACACACATACTCCCCATGGCAGCTGCAGGGGAAGTGGTGATGCTTGGTGGCAT
TCTCCTCCCTCTCCTCCTGGTTGTCGCCGTCTCCGGTGAGCCGCCGCCGATCAGCCGGAG
GAGCTTCCCCGAGGGGTTCATCTTCGGGACGGCCTCGTCGTCGTATCAGTATGAGGGTGG
CGCCAGAGAGGGGGGCAGAGGACCAAGCATCTGGGACACATTCACACACCAGCACCCAGA
TAAGATTGCTGACAAAAGCAATGGGGACGTGGCTGCAGACTCCTACCATCTATACAAGGA
AGATGTGCGCATCATGAAGGATATGGGAGTGGATGCATATAGGTTCTCCATCTCATGGAC
AAGAATTCTTCCAAATGGAAGTCTGAGCGGTGGAATCAACAGAGAAGGCATCAGCTACTA
CAACAATTTGATCAATGAACTATTACTGAAAGGGGTGCAACCATTTGTTACCCTTTTCCA
CTGGGACTCGCCACAGGCATTAGAAGATAAATATAATGGATTTCTTAGCCCTAATATCAT
AAATGACTATAAGGAGTACGCTGAAACCTGCTTCAAAGAGTTTGGTGACAGAGTGAAACA
TTGGATCACCTTCAATGAGCCTTTGAGCTTCTGTGTTGCGGGATATGCATCAGGTGGCAT
GTTTGCACCAGGCCGCTGTTCGCCTTGGGAGGGAAATTGCAGTGCTGGCGATTCAGGAAG
GGAGCCTTACACCGCATGCCATCATCAACTACTTGCTCATGCGGAAACTGTTCGGTTGTA
CAAAGAGAAATATCAGGTCTTACAAAAGGGGAAGATTGGAATAACTTTGGTCTCGAACTG
GTTTGTTCCCTTCTCCCGCTCCAAATCCAACATCGATGCTGCAAGGCGTGCTTTAGACTT
CATGCTTGGATGGTTTATGGATCCCCTAATTAGAGGCGAGTACCCCCTAAGCATGAGAGA
ATTGGTTCGGAATCGCTTGCCTCAGTTCACTAAAGAACAATCTGAGTTGATCAAGGGTTC
ATTCGATTTTATTGGACTTAATTACTACACTTCAAATTATGCTGGTAGCCTTCCTCCATC
AAATGGCCTCAATAACAGCTATAGTACTGATGCTCGAGCTAATCTTACTGCTGTTCGAAA
CGGCATTCCCATAGGTCCTCAGGCTGCTTCGCCTTGGCTTTACATCTATCCTCAAGGGTT
CCGTGAATTGGTGCTTTATGTTAAGGAAAACTATGGCAATCCTACCATCTACATCACCGA
AAATGGTGTTGATGAATTCAACAATAAGACCTTACCACTCCAGGAAGCCTTGAAGGATGA
CACTAGAATAGATTACTACCACAAGCACCTCCTTTCACTGCTAAGTGCAATAAGGGACGG
AGCAAATGTGAAGGGATACTTTGCATGGTCGCTGCTTGATAACTTCGAGTGGTCGAACGG
CTATACTGTTCGCTTTGGGATAAACTTTGTGGATTACAATGACGGAGCGAAGAGATACCC
CAAAATGTCTGCCCATTGGTTCAAGGAGTTCCTCCAGAAATGATGAAAATAAAAGCGTGT
GAAGAGTTGCACACATTGCTCTTCCCATTTTGAACAGCAAAGAGCATATATGTTACAACA
GATGGAGGTATTGCAAGTTTGCAACTAAATAAATCTCTGTCTTCACTCTCTGCGTATAGC
TAGCTAAGCGATGGATAGAGAGTTACATCTTCTCTTACGCATATTTCAAAAAATTTAAGA
GGTTGTAGTAACTTCTTCATCATATTTTGGAGATGCGATCATAGCACAGTGGCAGAGGTT
GCTGGCATGCACCGTCCACGCAGGTTCGATTCTCCTTGAGCACGGCTCACC

CDS

1521 bp

>Os04t0474900-01 β-glucosidase
ATGGCAGCTGCAGGGGAAGTGGTGATGCTTGGTGGCATTCTCCTCCCTCTCCTCCTGGTT
GTCGCCGTCTCCGGTGAGCCGCCGCCGATCAGCCGGAGGAGCTTCCCCGAGGGGTTCATC
TTCGGGACGGCCTCGTCGTCGTATCAGTATGAGGGTGGCGCCAGAGAGGGGGGCAGAGGA
CCAAGCATCTGGGACACATTCACACACCAGCACCCAGATAAGATTGCTGACAAAAGCAAT
GGGGACGTGGCTGCAGACTCCTACCATCTATACAAGGAAGATGTGCGCATCATGAAGGAT
ATGGGAGTGGATGCATATAGGTTCTCCATCTCATGGACAAGAATTCTTCCAAATGGAAGT
CTGAGCGGTGGAATCAACAGAGAAGGCATCAGCTACTACAACAATTTGATCAATGAACTA
TTACTGAAAGGGGTGCAACCATTTGTTACCCTTTTCCACTGGGACTCGCCACAGGCATTA
GAAGATAAATATAATGGATTTCTTAGCCCTAATATCATAAATGACTATAAGGAGTACGCT
GAAACCTGCTTCAAAGAGTTTGGTGACAGAGTGAAACATTGGATCACCTTCAATGAGCCT
TTGAGCTTCTGTGTTGCGGGATATGCATCAGGTGGCATGTTTGCACCAGGCCGCTGTTCG
CCTTGGGAGGGAAATTGCAGTGCTGGCGATTCAGGAAGGGAGCCTTACACCGCATGCCAT
CATCAACTACTTGCTCATGCGGAAACTGTTCGGTTGTACAAAGAGAAATATCAGGTCTTA
CAAAAGGGGAAGATTGGAATAACTTTGGTCTCGAACTGGTTTGTTCCCTTCTCCCGCTCC
AAATCCAACATCGATGCTGCAAGGCGTGCTTTAGACTTCATGCTTGGATGGTTTATGGAT
CCCCTAATTAGAGGCGAGTACCCCCTAAGCATGAGAGAATTGGTTCGGAATCGCTTGCCT
CAGTTCACTAAAGAACAATCTGAGTTGATCAAGGGTTCATTCGATTTTATTGGACTTAAT
TACTACACTTCAAATTATGCTGGTAGCCTTCCTCCATCAAATGGCCTCAATAACAGCTAT
AGTACTGATGCTCGAGCTAATCTTACTGCTGTTCGAAACGGCATTCCCATAGGTCCTCAG
GCTGCTTCGCCTTGGCTTTACATCTATCCTCAAGGGTTCCGTGAATTGGTGCTTTATGTT
AAGGAAAACTATGGCAATCCTACCATCTACATCACCGAAAATGGTGTTGATGAATTCAAC
AATAAGACCTTACCACTCCAGGAAGCCTTGAAGGATGACACTAGAATAGATTACTACCAC
AAGCACCTCCTTTCACTGCTAAGTGCAATAAGGGACGGAGCAAATGTGAAGGGATACTTT
GCATGGTCGCTGCTTGATAACTTCGAGTGGTCGAACGGCTATACTGTTCGCTTTGGGATA
AACTTTGTGGATTACAATGACGGAGCGAAGAGATACCCCAAAATGTCTGCCCATTGGTTC
AAGGAGTTCCTCCAGAAATGA

Protein

507 aa

>Os04t0474900-01 β-glucosidase
MAAAGEVVMLGGILLPLLLVVAVSGEPPPISRRSFPEGFIFGTASSSYQYEGGAREGGRG
PSIWDTFTHQHPDKIADKSNGDVAADSYHLYKEDVRIMKDMGVDAYRFSISWTRILPNGS
LSGGINREGISYYNNLINELLLKGVQPFVTLFHWDSPQALEDKYNGFLSPNIINDYKEYA
ETCFKEFGDRVKHWITFNEPLSFCVAGYASGGMFAPGRCSPWEGNCSAGDSGREPYTACH
HQLLAHAETVRLYKEKYQVLQKGKIGITLVSNWFVPFSRSKSNIDAARRALDFMLGWFMD
PLIRGEYPLSMRELVRNRLPQFTKEQSELIKGSFDFIGLNYYTSNYAGSLPPSNGLNNSY
STDARANLTAVRNGIPIGPQAASPWLYIYPQGFRELVLYVKENYGNPTIYITENGVDEFN
NKTLPLQEALKDDTRIDYYHKHLLSLLSAIRDGANVKGYFAWSLLDNFEWSNGYTVRFGI
NFVDYNDGAKRYPKMSAHWFKEFLQK*

5'UTR

chr04:23767380..23767401 (- strand) : 22 bp

CDS

chr04:23767233..23767379 (- strand) : 147 bp

chr04:23766880..23766949 (- strand) : 70 bp

chr04:23766200..23766258 (- strand) : 59 bp

chr04:23765906..23765981 (- strand) : 76 bp

chr04:23765653..23765730 (- strand) : 78 bp

chr04:23765428..23765515 (- strand) : 88 bp

chr04:23764939..23765194 (- strand) : 256 bp

chr04:23764307..23764422 (- strand) : 116 bp

chr04:23764010..23764227 (- strand) : 218 bp

chr04:23763563..23763594 (- strand) : 32 bp

chr04:23763370..23763472 (- strand) : 103 bp

chr04:23763032..23763140 (- strand) : 109 bp

chr04:23762773..23762941 (- strand) : 169 bp

3'UTR

chr04:23762465..23762772 (- strand) : 308 bp

FASTA

>Os04t0474900-01 class=Sequence position=chr04:23762465..23767401 (- strand)
GGGTCACACA CACATACTCC CCATGGCAGC TGCAGGGGAA GTGGTGATGC TTGGTGGCAT TCTCCTCCCT CTCCTCCTGG
TTGTCGCCGT CTCCGGTGAG CCGCCGCCGA TCAGCCGGAG GAGCTTCCCC GAGGGGTTCA TCTTCGGGAC GGCCTCGTCG
TCGTATCAGG TTAAGCTTCC ACTTCCCTTC CAATCCTACA GTTCGATTGG TACCGAACTC AGTTCTCTAC TTCTCTCAAG
AACATTTGTT ACAAGTTGCA AAAGGCTCTC TCTCTCTCTC AATCTACAGA TATGATAGAT GTACAACACT AAAATGACAG
ACACAATATT TTCTATTGAA TAATGCCAAA ATTGTCAGGA ATGTATGGCC TGATCTAATA GGCATTGGGT GCCAATTGTG
TCTTTGTTTT GGTCTGAAAT CTGAAGAATT GGCCGTTGCT TCACACATGC AGTATGAGGG TGGCGCCAGA GAGGGGGGCA
GAGGACCAAG CATCTGGGAC ACATTCACAC ACCAGCACCC AGGCATGTTA ATTACATCTC CCGTTTGCCT CCGCCTTCCA
TGCTACACAT CAATACAGTT TTGTGTTAGT CAAGCTTAAC TAAGTATGAT TTATATGTTG ACAAAAAAAA TTAATCATAA
TTAGCAACAT CTCTACTTCA ATCAACGATA CCCTGCATAT ACATATGGTA TTGTAGAAGA TGTGCGTCTG GCTGTGTGAT
CATGTTTTTT GCTTTCCAGG TTGGTTGGTT TTATTTATAG TTAGACGATC TGATTATCTA AAATGGAATC ATTATCTGTT
ATTGATCGTG GCGATTCATG GGGAGGTTGT GTGGAAGATT TTGCTCTTCC TAATAGTTCA GTGGGTATCT TGAACTAGTA
GTCCAATCAT GTCTTTTTTT AAAAAAAACA ATCATAACCC AATTAAGATG ATTGATCAAG CAGTCACTAT CGTCTCCAAG
ACCTTTCATC CACACATTTG TTATTGCATT CAATTAGCAA AACAAGCTTT GAATTCTTGA CCTATTGTAC ACAATAGTCC
AAAAGGGCAA ATGAAGAAAC TTGAGCGTAT GATTGATATA AATGACAAGA AACAACAGAC AAGGACACAT CCTCTTTTTA
TTGACAATTC TCTGGTTTGA CAGATAAGAT TGCTGACAAA AGCAATGGGG ACGTGGCTGC AGACTCCTAC CATCTATACA
AGGTATAGAA ATTAGCCTTT TTCAAGTAGC AGCTTATGGT TTTTTTAATT GATTTTTTTT TGTAAGGGTT ATGCTCCAAT
TAAAATATAC TCTAAATTGT GTTAGGTTGT TCTACTCCCT CTAGGAGAGT AGGAGATAAT CTCTTCACAT TTTAATTCCA
ACCTTCTTTC GGAAAAAATA ATTTACTACT TATCCAGAGG AACTTGCAAA ACCAATGCAG GAAGATGTGC GCATCATGAA
GGATATGGGA GTGGATGCAT ATAGGTTCTC CATCTCATGG ACAAGAATTC TTCCAAGTGT GTGGCTATAT CTTCCAGACC
TGATGCAATG CACTGTCAAA CGCATATAGA AAGATAACTT TAACTCATCT GAAGTTGATC TCATTTTTAT TCTGAAGTAT
AAGAATTTGC ATATCTTTCT GACTACAAGT TGATCCCTGG AGAGACATTA AAATCTCACT TGTCATGGCA GATGGAAGTC
TGAGCGGTGG AATCAACAGA GAAGGCATCA GCTACTACAA CAATTTGATC AATGAACTAT TACTGAAAGG TATGCAACTC
TTCAGTGGTT TTATCTAAAA AGAAGTGTTC AGTGTTAAGT TTCCAGTTCA GTTCAGTGGC TACATGCAAT ATGTGTGGAC
CATTGGATAT TTTTTTTCAA GATGCATAAT AGTCTTACAC TTGCAGGGGT GCAACCATTT GTTACCCTTT TCCACTGGGA
CTCGCCACAG GCATTAGAAG ATAAATATAA TGGATTTCTT AGCCCTAATA TCATGTGAGT CCACAATTCT TCAGTACCTT
TTTCTTGTTA AATAAATCAC TAGTTAAACA TGGATTAATT GAATTGGAAA CTGTTCAAGT TTGTAAGATA GAGATGTTAT
TGTACCAAAA ATCAAATACG CGCTGACTTC ACCCAAAATA ATACCTTCCT GTATCTTTTC AGCTAAAACA TCTAAAGTTA
CTGCGAAAAA GAAGGTGCTA AAATTACTGA CTGAAAAATC GTTGCAGAAA TGACTATAAG GAGTACGCTG AAACCTGCTT
CAAAGAGTTT GGTGACAGAG TGAAACATTG GATCACCTTC AATGAGCCTT TGAGCTTCTG TGTTGCGGGA TATGCATCAG
GTGGCATGTT TGCACCAGGC CGCTGTTCGC CTTGGGAGGG AAATTGCAGT GCTGGCGATT CAGGAAGGGA GCCTTACACC
GCATGCCATC ATCAACTACT TGCTCATGCG GAAACTGTTC GGTTGTACAA AGAGAAATAT CAGGTCACCA AAAGAATCCG
TTTAGCACTT GCAAATCATC CGTGATAATG ATTTTGATAG TCCAAAATGT TTTTCTTGCT TGTCATTTAG TTTCAGTGCT
GTCCTGGTAG TAGATTTGTT AGTAGAGCTC TTAGCCAATT ACTTTAGGAA CCGCAGCTAG CTATTCTAGA CATCGAATAT
AACGACTAGG TTATTACATA TACATGTGGA TAGACTAATG TATGTCTTTT ATTAAAAAAA AAAACTCATG CAATTTACTA
CTCATAATAA TATATTGTAA ACCTTATAAA TTGATATTTG AATCCGAATG TAATGTTTGT AGATATGTTT TAGTTCTAAT
TAATATGGAA TGAAAAACAC CCTGACTGTA CATGCACATC GAACTCAAGA AGTACTTCAT GCAAGAAAAG AAAACACAGA
ACACTTAGTA GAATATATGT AATGTTTGCA AAATCAAAGA TTTGGGTTCA ACATACAGAC ATCCTTGCGG TTGATCAATA
AAATGCTTGT CAAATTCAGG TCTTACAAAA GGGGAAGATT GGAATAACTT TGGTCTCGAA CTGGTTTGTT CCCTTCTCCC
GCTCCAAATC CAACATCGAT GCTGCAAGGC GTGCTTTAGA CTTCATGCTT GGATGGTAAA TTCTCTGCCA CACATAATTT
GAACATTCAT GTCTAAACCA GGCAGAAGGC ACAAACTATG AATTCCCTTT GTAGGTTTAT GGATCCCCTA ATTAGAGGCG
AGTACCCCCT AAGCATGAGA GAATTGGTTC GGAATCGCTT GCCTCAGTTC ACTAAAGAAC AATCTGAGTT GATCAAGGGT
TCATTCGATT TTATTGGACT TAATTACTAC ACTTCAAATT ATGCTGGTAG CCTTCCTCCA TCAAATGGCC TCAATAACAG
CTATAGTACT GATGCTCGAG CTAATCTTAC TGGTGAGTCA AAAAAAGTAA TGAATTTGTC GTTCTGTTTT AAATTCGCAT
TTCACAGTGT TTGCAACCGT GAAATACAAT CATATGACAA CTTTCTGGCA CAAAATATAC TTAAAACTGT AGCATAAGCA
TTTAGCCAGC TCATATCATG GTCTCTGTTG CATTTTTCAA TTATCCTTTT TGTTTCAAAA GGGTTCATCA AATTTCCTCC
CTATAAATAT CCATGCTCTT TCATGCATGA ATGAAATGAA AGTAATGCAC AAAGATAAGT AAGTATAGGT AATCTAGTAA
TTTTCAGTAC GTTTTTAATT AGTTTGTGCA CAAGGAAACA ATACACACTA AATGCATTAT CAAATACTAT GTACTCCCCA
ACATTATTGC CTCATCAATA TATGCTAACC TTGTCTGATT ATGCCAGCTG TTCGAAACGG CATTCCCATA GGTCCTCAGG
TAACTCCATA CTTTGTCCTC CACACAAAAT GAATTAACAG CTAAATAATT CACGTGAGAT ATTGAATTCT GTAAATGACA
TGTATGTAGG CTGCTTCGCC TTGGCTTTAC ATCTATCCTC AAGGGTTCCG TGAATTGGTG CTTTATGTTA AGGAAAACTA
TGGCAATCCT ACCATCTACA TCACCGAAAA TGGTAAGTGC TACTGTGCTA GTCAATATGT TATCCAGTGT TTAGTGTGTA
ACTGATACTA CTATTACACC TTCCGACATT GCAATGAATT AAGTCAACAA TACAGTAAAA ACACATTTGA ATCAATTATA
TTTTCCTCTC CTGGCTATTT GAAGAGGGGG GAATATCTCC TTTCCTAAGA GTTAATGAAT CTTATTGATT TTCTTTCTCT
TTTTTTTTTT GGTGTCTTAA GGTGTTGATG AATTCAACAA TAAGACCTTA CCACTCCAGG AAGCCTTGAA GGATGACACT
AGAATAGATT ACTACCACAA GCACCTCCTT TCACTGCTAA GTGCAATAAG GTATGAACTT CGAGCATATC ATACACTCAT
CTTTGAGTAA GAGTACTTCA GATGTTAGTT GACAGTGCAT TACTCCATAT GAATTTCTAG GGACGGAGCA AATGTGAAGG
GATACTTTGC ATGGTCGCTG CTTGATAACT TCGAGTGGTC GAACGGCTAT ACTGTTCGCT TTGGGATAAA CTTTGTGGAT
TACAATGACG GAGCGAAGAG ATACCCCAAA ATGTCTGCCC ATTGGTTCAA GGAGTTCCTC CAGAAATGAT GAAAATAAAA
GCGTGTGAAG AGTTGCACAC ATTGCTCTTC CCATTTTGAA CAGCAAAGAG CATATATGTT ACAACAGATG GAGGTATTGC
AAGTTTGCAA CTAAATAAAT CTCTGTCTTC ACTCTCTGCG TATAGCTAGC TAAGCGATGG ATAGAGAGTT ACATCTTCTC
TTACGCATAT TTCAAAAAAT TTAAGAGGTT GTAGTAACTT CTTCATCATA TTTTGGAGAT GCGATCATAG CACAGTGGCA
GAGGTTGCTG GCATGCACCG TCCACGCAGG TTCGATTCTC CTTGAGCACG GCTCACC

Locus: Os04g0474900

Loading...

Locus: Os04g0474900

Loading...