Os04t0476700-01

Locus

Os04g0476700

Description

Leucine-rich repeat, typical subtype containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsIRL3, IRL3

Oryzabase Gene Name Synonym(s)

intracellular Ras-group-related LRR protein 3

Transcript Evidence

AK071870 (DDBJ, Best hit)

Protein Evidence

Q7XK44 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Leucine-rich repeat (IPR001611)

Leucine-rich repeat, typical subtype (IPR003591)

Full-length cDNA

J023116G14 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0476700-01)

RiceXPro (AK071870)

Others

Oryzabase (14434)

KEGG (Os04t0476700-01)

Transcript

1002 bp

>Os04t0476700-01 Leucine-rich repeat, typical subtype containing protein.
GTTATTCCAGATGCTATAGGAGGACTTGATCATCTTGAAGAGCTTCGTCTTGCTTCCAAT
GCCTTGATTTCTCTTCCTGATTCCATTGGACTGCTATTGAATTTGAGGATTCTGAATGTG
GGAAGCAACAGGCTAAGGTCATTGCCAGATAGCATCTCAAAGTGCAGGTCATTAATTGAG
CTTGATGCGAGCTACAACGGGCTCGCTTATCTGCCAACCAACATTGGGTATGAGCTGGTA
AATCTGCGGAAACTCTGGGTCCATATGAACAAGTTGCGGTCACTTCCATCATCTATCTGC
GAGATGAGATCATTGTACCTCCTGGATGCACATTTCAATGAACTATGTGGTCTGCCATCT
GCCATAGGGAAACTTTCAAGTCTTGAAATTCTGAACCTGAGCAGCAACTTTAGTGACCTG
AAGGATCTCCCTGCTTCTTTCGGTGACCTGCTGAATCTGCGCGAGCTTGACCTCAGCAAC
AACCAGATCCATGCTCTTCCCGACAATTTTGGTCGGCTGGATAAGCTAGAGAAGCTCAAC
CTGGAGCAAAATCCCCTTTCTATGCCGCCAATGGAGATCGTGAACAAAGGCGTGGACGCG
GTGAAAGAATACATGTTGCAGAGGTGGCTTGACATCTTGCTCGAGGAAGAACGGAAGAGC
ATCGCAGCAGCGGAGAGCCCTCAAGCACCGACCACTCCTTCGGCCTGGCTGGCACGCAGC
GTCTCCTGGGTCTCCGACGTTTCCGGAAGCCTTGTGGGGTACCTCAGTGGCGAGAACAAG
ACGGAGAAAGATGCCTACCTGGATCAGCAGTACTGAAAGCGCTCACCTGTGTGGTGTTTG
TGCACCGTGTACATACTATAAGCGTTCCATGCTTACCATCTCATCTGGGAAAATCGTTTT
GTGTTCCTGGTGAGTCGAGCCATACACTCGTGCTAGGCTTGCATCCCCCAAAGCAGGCTT
TGGGGTTTATTTTGCCCGTTTTAACTTCCGGACGTCCTTTTC

CDS

816 bp

>Os04t0476700-01 Leucine-rich repeat, typical subtype containing protein.
GTTATTCCAGATGCTATAGGAGGACTTGATCATCTTGAAGAGCTTCGTCTTGCTTCCAAT
GCCTTGATTTCTCTTCCTGATTCCATTGGACTGCTATTGAATTTGAGGATTCTGAATGTG
GGAAGCAACAGGCTAAGGTCATTGCCAGATAGCATCTCAAAGTGCAGGTCATTAATTGAG
CTTGATGCGAGCTACAACGGGCTCGCTTATCTGCCAACCAACATTGGGTATGAGCTGGTA
AATCTGCGGAAACTCTGGGTCCATATGAACAAGTTGCGGTCACTTCCATCATCTATCTGC
GAGATGAGATCATTGTACCTCCTGGATGCACATTTCAATGAACTATGTGGTCTGCCATCT
GCCATAGGGAAACTTTCAAGTCTTGAAATTCTGAACCTGAGCAGCAACTTTAGTGACCTG
AAGGATCTCCCTGCTTCTTTCGGTGACCTGCTGAATCTGCGCGAGCTTGACCTCAGCAAC
AACCAGATCCATGCTCTTCCCGACAATTTTGGTCGGCTGGATAAGCTAGAGAAGCTCAAC
CTGGAGCAAAATCCCCTTTCTATGCCGCCAATGGAGATCGTGAACAAAGGCGTGGACGCG
GTGAAAGAATACATGTTGCAGAGGTGGCTTGACATCTTGCTCGAGGAAGAACGGAAGAGC
ATCGCAGCAGCGGAGAGCCCTCAAGCACCGACCACTCCTTCGGCCTGGCTGGCACGCAGC
GTCTCCTGGGTCTCCGACGTTTCCGGAAGCCTTGTGGGGTACCTCAGTGGCGAGAACAAG
ACGGAGAAAGATGCCTACCTGGATCAGCAGTACTGA

Protein

272 aa

>Os04t0476700-01 Leucine-rich repeat, typical subtype containing protein.
VIPDAIGGLDHLEELRLASNALISLPDSIGLLLNLRILNVGSNRLRSLPDSISKCRSLIE
LDASYNGLAYLPTNIGYELVNLRKLWVHMNKLRSLPSSICEMRSLYLLDAHFNELCGLPS
AIGKLSSLEILNLSSNFSDLKDLPASFGDLLNLRELDLSNNQIHALPDNFGRLDKLEKLN
LEQNPLSMPPMEIVNKGVDAVKEYMLQRWLDILLEEERKSIAAAESPQAPTTPSAWLARS
VSWVSDVSGSLVGYLSGENKTEKDAYLDQQY*

CDS

chr04:23866055..23866221 (+ strand) : 167 bp

chr04:23866298..23866946 (+ strand) : 649 bp

3'UTR

chr04:23866947..23867132 (+ strand) : 186 bp

FASTA

>Os04t0476700-01 class=Sequence position=chr04:23866055..23867132 (+ strand)
GTTATTCCAG ATGCTATAGG AGGACTTGAT CATCTTGAAG AGCTTCGTCT TGCTTCCAAT GCCTTGATTT CTCTTCCTGA
TTCCATTGGA CTGCTATTGA ATTTGAGGAT TCTGAATGTG GGAAGCAACA GGCTAAGGTC ATTGCCAGAT AGCATCTCAA
AGTGCAGGTA GATAACTTTC TTTAGCTTAA CTCTTGGGTT CAGCAAATGT TACTGTTCAA GTGACTGATT GGTGCAACTC
CAGGTCATTA ATTGAGCTTG ATGCGAGCTA CAACGGGCTC GCTTATCTGC CAACCAACAT TGGGTATGAG CTGGTAAATC
TGCGGAAACT CTGGGTCCAT ATGAACAAGT TGCGGTCACT TCCATCATCT ATCTGCGAGA TGAGATCATT GTACCTCCTG
GATGCACATT TCAATGAACT ATGTGGTCTG CCATCTGCCA TAGGGAAACT TTCAAGTCTT GAAATTCTGA ACCTGAGCAG
CAACTTTAGT GACCTGAAGG ATCTCCCTGC TTCTTTCGGT GACCTGCTGA ATCTGCGCGA GCTTGACCTC AGCAACAACC
AGATCCATGC TCTTCCCGAC AATTTTGGTC GGCTGGATAA GCTAGAGAAG CTCAACCTGG AGCAAAATCC CCTTTCTATG
CCGCCAATGG AGATCGTGAA CAAAGGCGTG GACGCGGTGA AAGAATACAT GTTGCAGAGG TGGCTTGACA TCTTGCTCGA
GGAAGAACGG AAGAGCATCG CAGCAGCGGA GAGCCCTCAA GCACCGACCA CTCCTTCGGC CTGGCTGGCA CGCAGCGTCT
CCTGGGTCTC CGACGTTTCC GGAAGCCTTG TGGGGTACCT CAGTGGCGAG AACAAGACGG AGAAAGATGC CTACCTGGAT
CAGCAGTACT GAAAGCGCTC ACCTGTGTGG TGTTTGTGCA CCGTGTACAT ACTATAAGCG TTCCATGCTT ACCATCTCAT
CTGGGAAAAT CGTTTTGTGT TCCTGGTGAG TCGAGCCATA CACTCGTGCT AGGCTTGCAT CCCCCAAAGC AGGCTTTGGG
GTTTATTTTG CCCGTTTTAA CTTCCGGACG TCCTTTTC

Locus: Os04g0476700

Loading...

Locus: Os04g0476700

Loading...