Os04t0483500-01

Locus

Os04g0483500

Description

Beta-ketoacyl-CoA reductase, Cuticular wax biosynthesis, Fatty acid elongation

RAP-DB Gene Symbol Synonym(s)

KCR1, OsKCR1, WSL3

RAP-DB Gene Name Synonym(s)

beta-ketoacyl-CoA reductase 1, Wax crystal-sparse leaf 3

CGSNL Gene Symbol

KCR1

CGSNL Gene Name

BETA-KETOACYL-COA REDUCTASE 1

Oryzabase Gene Symbol Synonym(s)

OsKCR1, OsWSL3, WSL3

Oryzabase Gene Name Synonym(s)

beta-ketoacyl-CoA reductase 1, Wax crystal-sparse leaf 3

Transcript Evidence

AK060512

Protein Evidence

Q7XQF8

Literature

PMID: 27106031

Note

Manual Curation

April 25, 2016

Functional domain (InterPro)

Short-chain dehydrogenase/reductase SDR (IPR002347)

NAD(P)-binding domain (IPR016040)

Full-length cDNA

001-019-E03 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0483500-01)

RiceXPro (AK060512)

Others

Oryzabase (18134)

KEGG (Os04t0483500-01 (EC:1.1.1.-))

Transcript

1299 bp

>Os04t0483500-01 Beta-ketoacyl-CoA reductase, Cuticular wax biosynthesis, Fatty acid elongation
ATCGCAACTCGCACACGCTCGCCACTCTCCTCGCCGCCGCCGCCGCCGCCGCCTTCGCCG
CGGTCTCCGCCGCTGCCCGCCCCGTCTCCAGAAATGGACGCGCTGTCCGCGCAGCCGGCG
TGGGCGCTGGCGCTGGCCGGGGTGGGCCTCATGGTGGCCGCGACCGCCTCGGCGCGCCTC
GCGCGGTGGCTCTACGCGGCGTTCCTCCGCCCGGGGAAGCCCCTGCGCCGCCGGTACGGC
GAGTGGGCGGTCGTCACGGGCGCCACGGACGGCATCGGCCGCGCGCTCGCGTTCCGCTTC
GCGGGCGCCGGGATGAGCCTCGTGCTCGTGGGCCGCAGCCCCGACAAGCTGGCCGCGGTC
TCCGGGGAGATCAGGGGGAAGCACCCCAGGGCCGAGGTCCGCACCTTCGTGCTCGACTTC
GCCGCCGAGGGCCTCGCCGCCAAGGTGGCCGCGCTCGGGGACTCCATCCGCGGGCTCGAC
GTCGGCGTGCTCGTCAACAGCGCCGGCATGTCGTACCCGTACGCGCGCTACTTCCACGAG
GTGGACGAGGAGCTGATGCGCAACCTCATCCGCCTCAACGTCGAGGCGCTCACCCGGGTC
ACCCACGCCGTGCTCCCAGGCATGGTGGAGCGCAAGCGCGGCGCCATCGTCAACATCGGC
TCCGGCGCCTCCTCCATCCTGCCGTCCTACCCGCTCTACAGCGTCTACGCCGCCACCAAG
GCGTATGTTGATCAATTCTCGAGATGCCTCTATGTTGAGTACAAGAACAAAGGCATCGAT
GTGCAATGCCAGGTACCCCTGTACGCGGCGACGAAGATGGCGTCCATCAAGAAGGCGTCC
TTCTTCGCGCCGTCGCCGGAGACGTACGCCCGCGCCGCCGTGCGCTACATCGGGTACGAG
CCGAGGTGCACGCCCTACTGGCCGCACGCGGTGCTGTGGTTCCTCATCTCCGCGTTCCCG
GAGCCCATCGTGGACAGGCTCCTCCTCAACATGTCCGTCGGCATCCGCAAGAGGGGCATG
GCCAAGGACGCCAGGAAGAAGACGCAGTGACGAACCAGCACCAAAGAATCTGAGCGATAG
TACTCTCTACTTCTTCTCCTCTGCAGCTTCCGAAACATTGGGCGTTTGATTTACCCCGTA
TCTCTGGATTAGTTCTTCTCATGAGTAAGGTGATGATGAGCTGATGGTTAAACAGTGTGT
CTGGTTTGATGTACTAAGATTGAAGAGTTTAAGACCATGTGACACGAACTCGATCTGGCC
TGGTTAATAAAGCGCGGGAAAAAGGCTTTGCCTTCTGCT

CDS

957 bp

>Os04t0483500-01 Beta-ketoacyl-CoA reductase, Cuticular wax biosynthesis, Fatty acid elongation
ATGGACGCGCTGTCCGCGCAGCCGGCGTGGGCGCTGGCGCTGGCCGGGGTGGGCCTCATG
GTGGCCGCGACCGCCTCGGCGCGCCTCGCGCGGTGGCTCTACGCGGCGTTCCTCCGCCCG
GGGAAGCCCCTGCGCCGCCGGTACGGCGAGTGGGCGGTCGTCACGGGCGCCACGGACGGC
ATCGGCCGCGCGCTCGCGTTCCGCTTCGCGGGCGCCGGGATGAGCCTCGTGCTCGTGGGC
CGCAGCCCCGACAAGCTGGCCGCGGTCTCCGGGGAGATCAGGGGGAAGCACCCCAGGGCC
GAGGTCCGCACCTTCGTGCTCGACTTCGCCGCCGAGGGCCTCGCCGCCAAGGTGGCCGCG
CTCGGGGACTCCATCCGCGGGCTCGACGTCGGCGTGCTCGTCAACAGCGCCGGCATGTCG
TACCCGTACGCGCGCTACTTCCACGAGGTGGACGAGGAGCTGATGCGCAACCTCATCCGC
CTCAACGTCGAGGCGCTCACCCGGGTCACCCACGCCGTGCTCCCAGGCATGGTGGAGCGC
AAGCGCGGCGCCATCGTCAACATCGGCTCCGGCGCCTCCTCCATCCTGCCGTCCTACCCG
CTCTACAGCGTCTACGCCGCCACCAAGGCGTATGTTGATCAATTCTCGAGATGCCTCTAT
GTTGAGTACAAGAACAAAGGCATCGATGTGCAATGCCAGGTACCCCTGTACGCGGCGACG
AAGATGGCGTCCATCAAGAAGGCGTCCTTCTTCGCGCCGTCGCCGGAGACGTACGCCCGC
GCCGCCGTGCGCTACATCGGGTACGAGCCGAGGTGCACGCCCTACTGGCCGCACGCGGTG
CTGTGGTTCCTCATCTCCGCGTTCCCGGAGCCCATCGTGGACAGGCTCCTCCTCAACATG
TCCGTCGGCATCCGCAAGAGGGGCATGGCCAAGGACGCCAGGAAGAAGACGCAGTGA

Protein

318 aa

>Os04t0483500-01 Beta-ketoacyl-CoA reductase, Cuticular wax biosynthesis, Fatty acid elongation
MDALSAQPAWALALAGVGLMVAATASARLARWLYAAFLRPGKPLRRRYGEWAVVTGATDG
IGRALAFRFAGAGMSLVLVGRSPDKLAAVSGEIRGKHPRAEVRTFVLDFAAEGLAAKVAA
LGDSIRGLDVGVLVNSAGMSYPYARYFHEVDEELMRNLIRLNVEALTRVTHAVLPGMVER
KRGAIVNIGSGASSILPSYPLYSVYAATKAYVDQFSRCLYVEYKNKGIDVQCQVPLYAAT
KMASIKKASFFAPSPETYARAAVRYIGYEPRCTPYWPHAVLWFLISAFPEPIVDRLLLNM
SVGIRKRGMAKDARKKTQ*

5'UTR

chr04:24178860..24178952 (- strand) : 93 bp

CDS

chr04:24178231..24178859 (- strand) : 629 bp

chr04:24177024..24177093 (- strand) : 70 bp

chr04:24175898..24176155 (- strand) : 258 bp

3'UTR

chr04:24175649..24175897 (- strand) : 249 bp

FASTA

>Os04t0483500-01 class=Sequence position=chr04:24175649..24178952 (- strand)
ATCGCAACTC GCACACGCTC GCCACTCTCC TCGCCGCCGC CGCCGCCGCC GCCTTCGCCG CGGTCTCCGC CGCTGCCCGC
CCCGTCTCCA GAAATGGACG CGCTGTCCGC GCAGCCGGCG TGGGCGCTGG CGCTGGCCGG GGTGGGCCTC ATGGTGGCCG
CGACCGCCTC GGCGCGCCTC GCGCGGTGGC TCTACGCGGC GTTCCTCCGC CCGGGGAAGC CCCTGCGCCG CCGGTACGGC
GAGTGGGCGG TCGTCACGGG CGCCACGGAC GGCATCGGCC GCGCGCTCGC GTTCCGCTTC GCGGGCGCCG GGATGAGCCT
CGTGCTCGTG GGCCGCAGCC CCGACAAGCT GGCCGCGGTC TCCGGGGAGA TCAGGGGGAA GCACCCCAGG GCCGAGGTCC
GCACCTTCGT GCTCGACTTC GCCGCCGAGG GCCTCGCCGC CAAGGTGGCC GCGCTCGGGG ACTCCATCCG CGGGCTCGAC
GTCGGCGTGC TCGTCAACAG CGCCGGCATG TCGTACCCGT ACGCGCGCTA CTTCCACGAG GTGGACGAGG AGCTGATGCG
CAACCTCATC CGCCTCAACG TCGAGGCGCT CACCCGGGTC ACCCACGCCG TGCTCCCAGG CATGGTGGAG CGCAAGCGCG
GCGCCATCGT CAACATCGGC TCCGGCGCCT CCTCCATCCT GCCGTCCTAC CCGCTCTACA GCGTCTACGC CGCCACCAAG
GCGTGAGTGC TTCTCACTTC TTCACCTTTC AACTCTTCAT CAGTAACGAT TTTTCTCTGC GTGTTCTTGC TTACTACTAC
TACATAGACG AGGCAGAAAA TTATTTTATG CTTTCAGTGA GATTTTTGGT ACAAGCTTTT TAGTTTTTGT GCTCTCTCAG
ATCAGTTGTT CTGGCATGGA CCACGGAAAT GGGGACTGGC ACAGTTAGAG TCAATTAAAT TCATACTTGA TTATATACTA
CTAGTATAAA ATTATGCTTC CATATTGTGA TTTGGGTTTA TTGATCGAGA GTTAGTGGTC ATGTGGATAC AAATGTCCAC
CAACATTTTC AGGGGTTTTC AGCTAGAAGC CTAGAATAGA GCACTGAGGT TTCTCCTGGG GGTTTATATG TAGATGGAGA
ACTTGTTGGA GGGTGTAGGA TTATGTATAT Agggcctgtg tagttcgcga aaagaaaatt tttgggtgtc acatcgcacg
tttgaccgga tgtcggaaag ggttttcgga cacaaatgaa aaaactaatt tcataactcg tctggaaacc gcgagacgaa
tcttttgagc ctaattaatc cgtcattagc taatgtaggt taatgtagca tttatggcta atcacggact aattaggctc
aaaagattcg tctcgcgatt tctcccctaa gtgtgcaatt agttttttaa tttatttata tttaatactc catgcatgtg
tccaaagatt tgatgtgatg tttttgggaa aaagtttctg ggaactaaac agggccATAT TCAAGTATTC CAGCAGTTTT
GTGAAAATTG AACTCAAAAC GTAGTTGCTT GATCATTTGC TCTGTGTTTG ATAATGTATA CGACAGCATG TTTATGTTGT
TTAATGTTTT ACTTTGGCAA GCAACACATA TATTTAGCTA TCCACAAGGT TCTCTTTCTT GCACGCTTTT TATATGTTTC
ACTAGTGGAA TGTGGAATTC ATGCTTTGTG ATGTGGTCAT TGGTTAATCT TTGCATAGAT ATTTTCCGCA GCACAATTGT
GTGACATCCA GCTACAACTG GATATAACTG AATTCAACTC AACATAGGGT CATATGTGGG CTTAAGTGAT TCATGCAACT
CTGTTTTCAA TCTTTTCAGG TATGTTGATC AATTCTCGAG ATGCCTCTAT GTTGAGTACA AGAACAAAGG CATCGATGTG
CAATGCCAGG TACGAAATAG CCATTCCTGA CGATGCATGA ATTTCTCTAA TTGTTCCCGG TTGTCTGCTA TCCATTTTTT
TTTTCATATG TTGCACGAAG CCGTTATTGC AATCATTACA TTTTTGTTTA TGGGCTATGG AGTAGAAGTT TTTATATGGT
CAGTGATCAC CTGAATTATA CAGTAATCCA AGAAATGTCC TTTCAACATG AACATGGTTT TGCCATGCTG TCCTAAAAAA
AAAAAACTTG TACTACATTG GGTACTTCCG CGATCTGCTG GATGGCCATG GCGATGATGA CATAACGCCC CAACAAGAAA
CTGAAACCTT CATGGCTGAA AGCTAAATGC ACTTCTACCG TGCTTTCAAT TCTTCCAACT GCTCCTAAGG CAGGCAAACA
GTGCATGTGG AAAATTAATG GGCATAACAT GCAGCGAAGC ATTAGGAGGA TAGGAGAATT CCATATAGCC CTATTTAAAA
CAAATCTGTT GGCCGACCTC TACCTGTTTT TCATTTTCCA TTACTTACAT CCTCGCTGTC GCTGTTGGGA ACGTCGTTAT
CTGGCACCAT TTATGTGTGT CAGCTGTTCG GCGTTTATCA AGATTGTCTT AGCTGCCGCA TCAGAATCTT TGTCTCTttc
ttttctaatt aagatacata ttttatctta gtttttgtta gaacgttttt taaactattg tgcattttat gaaaactttc
tatatgtata agttgattta aaatatcata taaatccatc ttcaattcaa ttaattacgc gttaatggtt ttttttgggt
gccctaaGTT AATTTTCATA GAAACGAGCA CCGACTGACT TGGATGGTTT TTTTTTTTAT GCGCAACTCA TAATCAGGTA
CCCCTGTACG CGGCGACGAA GATGGCGTCC ATCAAGAAGG CGTCCTTCTT CGCGCCGTCG CCGGAGACGT ACGCCCGCGC
CGCCGTGCGC TACATCGGGT ACGAGCCGAG GTGCACGCCC TACTGGCCGC ACGCGGTGCT GTGGTTCCTC ATCTCCGCGT
TCCCGGAGCC CATCGTGGAC AGGCTCCTCC TCAACATGTC CGTCGGCATC CGCAAGAGGG GCATGGCCAA GGACGCCAGG
AAGAAGACGC AGTGACGAAC CAGCACCAAA GAATCTGAGC GATAGTACTC TCTACTTCTT CTCCTCTGCA GCTTCCGAAA
CATTGGGCGT TTGATTTACC CCGTATCTCT GGATTAGTTC TTCTCATGAG TAAGGTGATG ATGAGCTGAT GGTTAAACAG
TGTGTCTGGT TTGATGTACT AAGATTGAAG AGTTTAAGAC CATGTGACAC GAACTCGATC TGGCCTGGTT AATAAAGCGC
GGGAAAAAGG CTTTGCCTTC TGCT

Locus: Os04g0483500

Loading...

Locus: Os04g0483500

Loading...