Os04t0488700-01

Locus

Os04g0488700

Description

AGC kinase, Positive regulation of disease resistance

RAP-DB Gene Symbol Synonym(s)

OsOxi1

RAP-DB Gene Name Synonym(s)

oxidative signal inducible 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsOxi1

Oryzabase Gene Name Synonym(s)

AGC Kinase OsOxi1, oxidative signal inducible 1

Transcript Evidence

AK067266

Protein Evidence

Q7XUE9

Literature

PMID: 21051443

PMID: 20739304

Note

Manual Curation

November 5, 2020

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Protein kinase-like domain superfamily (IPR011009)

Protein kinase domain (IPR000719)

AGC-kinase, C-terminal (IPR000961)

Serine/threonine-protein kinase, active site (IPR008271)

Full-length cDNA

J013098C22 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0488700-01)

RiceXPro (AK067266)

Others

Oryzabase (18114)

KEGG (Os04t0488700-01 (EC:2.7.11.1))

Transcript

1982 bp

>Os04t0488700-01 AGC kinase, Positive regulation of disease resistance
TCGCGCACCGACCCCACTCGGATCCTCTCCTCCCCTCCTCACTGCCTCTCTCCCGTCCAC
GAGCGGTTGGTCGATCGATCGATCGATCGGCGCGGTCCTTCGCCAGCCATGGCGGCGGCG
GCGATGGCGCCCTCGCCTCCGGAGCCGGCGTTGCCGCGGGAGCTCAGCCTGGGGGACCTC
AGGGCGGTGTCCATGCTCGGCCGGggcgccaagggcgtcgtgttccacgtcgtgcccgcg
gcggcgggggaggaggaggcctccatggcgctcaaggcggtctcgcgggaggcggcgcgg
cacaagaagaacgggagcggcggcgaggacgggcaccggcggatctggttcgagcgggac
gtgctcatgtcgctgcgacacccgctgctcccctccctccgcggcgtcctcgccaccgac
gccgtcgtcgggttcgccatcgaccgctgcggcggcggagacctcaactcgctccggcgc
cgcCAGACCGAGAAGATGTTCTCCGACTCCGTCATCCGCTTCTACGCCGCGGAGTTGGTG
CTGGCGCTCGACTATCTGCACAGCCTCGGCATCGTGTACCGCGACCTCAAGCCGGAGAAC
GTCCTGATACAGGACAGCGGCCACATCATGCTCGTCGACTTCGACCTCTCCACGAGGCTC
CCGACGCCGCCGCCGCCACCGGAGGAGCAGGACGCAACGATTGCTGATTCCATGCCGGAG
CCTCCGCCCAGTTCACCGTCCCCGAACCGCGCGAAGGGCAAGAGGCAACCGGGGGCGGCC
TCGTGCTTCCCGTTCTGTTCGGTCGGCGCCACGAAGCCGGCCGCGTCGGCGGACTCGCCG
TCGCCAACGTCCACCTCGCGCACGGCCTCGGCGTCGTCCTCGTCCTCATCCTCGACGGCC
ACCACCGCGTCGTCCTCCACCGCCGCTGGCGTGCGGTCGCCAGCGAAGTCGAACTCGTTC
GTGGGCACGGAGGACTACGTGGCGCCGGAGATCATCGCCGGCAGCGGGCACGACTTCTCC
GTGGACTGGTGGGGCCTGGGCGTGGTGCTCTACGAGATGCTCTACGGCCGCACGCCGTTC
CGGGGGCTGAACAGGAAGGAGACGTTCTACCGCGTCCTCTCCAAGCAGCCGGAGCTCGTC
GGCGAGAAGACGCCGCTGCGCGACCTCATCGCCCGCCTCCTGGAGAAGGACCCCGAGAAG
CGCATCGGCGCGCGCGGGATCAAGGCGCACCCGTTCTTCAACGGCGTCGACTGGGACCGC
ATCCTCCGCGTGGCGCGCCCGCCGTTCATCCCGCCCCCGCCGGAGGACGAGGACGAGGCC
GGCGAGGTGCTCGACGTCGAGAAGGTCGTCAACGAGGTGTTCGCGGCCAATGACGGCGGG
GCCGCAGCGGGTGTGGTGGAGAAGCCTTCGCCGGAGGCAGGTGGAACTCTGGCCGTCGGC
GATGGCGAGCAGAGGAGAGATCCGTCCAAAGAAGGCGATTTCTCCGTATTTTTCTGAGCG
TATTTATTGAGTTCTTTTTTAGCGTTCTCTCTCTTAAAAATGGAAAATTACATAGCTATT
TTGGTTTTTTCTATGGACTAGAATTATTATGGGGGTCTCTATTAGTAATAGACATAATTA
AGACAAAGTACGGCGCGGTGGAGTACATAAATCGACTTTGCTCTTGTGTTTAATGGAGTA
CAGTCTGTATAGTATTTTTCCCCTTTCCCTTTTATTTTCTTCTTTGTTGGATACATTTCC
CCGTGCAACGATGCAAGCTAGGGGATTACTGAAGAGTGTACATAAGGAATGATGAACAGC
AAAATTGGCCTAATGTTGTGTCCATCCATGTGTTCCATTTCGCTTTGGGTAGCCATTGAT
GTTAATACCTGTTACTTCCTTTCAGTGGGAGTAATAGAAATGGTCACGGTTTTGTACATT
TTTCTGCAACATTCTCTCAAAGTAGTAAATGCTTTGAAGTGCCCTTGCGCCATCAATGAG
GT

CDS

1389 bp

>Os04t0488700-01 AGC kinase, Positive regulation of disease resistance
ATGGCGGCGGCGGCGATGGCGCCCTCGCCTCCGGAGCCGGCGTTGCCGCGGGAGCTCAGC
CTGGGGGACCTCAGGGCGGTGTCCATGCTCGGCCGGggcgccaagggcgtcgtgttccac
gtcgtgcccgcggcggcgggggaggaggaggcctccatggcgctcaaggcggtctcgcgg
gaggcggcgcggcacaagaagaacgggagcggcggcgaggacgggcaccggcggatctgg
ttcgagcgggacgtgctcatgtcgctgcgacacccgctgctcccctccctccgcggcgtc
ctcgccaccgacgccgtcgtcgggttcgccatcgaccgctgcggcggcggagacctcaac
tcgctccggcgccgcCAGACCGAGAAGATGTTCTCCGACTCCGTCATCCGCTTCTACGCC
GCGGAGTTGGTGCTGGCGCTCGACTATCTGCACAGCCTCGGCATCGTGTACCGCGACCTC
AAGCCGGAGAACGTCCTGATACAGGACAGCGGCCACATCATGCTCGTCGACTTCGACCTC
TCCACGAGGCTCCCGACGCCGCCGCCGCCACCGGAGGAGCAGGACGCAACGATTGCTGAT
TCCATGCCGGAGCCTCCGCCCAGTTCACCGTCCCCGAACCGCGCGAAGGGCAAGAGGCAA
CCGGGGGCGGCCTCGTGCTTCCCGTTCTGTTCGGTCGGCGCCACGAAGCCGGCCGCGTCG
GCGGACTCGCCGTCGCCAACGTCCACCTCGCGCACGGCCTCGGCGTCGTCCTCGTCCTCA
TCCTCGACGGCCACCACCGCGTCGTCCTCCACCGCCGCTGGCGTGCGGTCGCCAGCGAAG
TCGAACTCGTTCGTGGGCACGGAGGACTACGTGGCGCCGGAGATCATCGCCGGCAGCGGG
CACGACTTCTCCGTGGACTGGTGGGGCCTGGGCGTGGTGCTCTACGAGATGCTCTACGGC
CGCACGCCGTTCCGGGGGCTGAACAGGAAGGAGACGTTCTACCGCGTCCTCTCCAAGCAG
CCGGAGCTCGTCGGCGAGAAGACGCCGCTGCGCGACCTCATCGCCCGCCTCCTGGAGAAG
GACCCCGAGAAGCGCATCGGCGCGCGCGGGATCAAGGCGCACCCGTTCTTCAACGGCGTC
GACTGGGACCGCATCCTCCGCGTGGCGCGCCCGCCGTTCATCCCGCCCCCGCCGGAGGAC
GAGGACGAGGCCGGCGAGGTGCTCGACGTCGAGAAGGTCGTCAACGAGGTGTTCGCGGCC
AATGACGGCGGGGCCGCAGCGGGTGTGGTGGAGAAGCCTTCGCCGGAGGCAGGTGGAACT
CTGGCCGTCGGCGATGGCGAGCAGAGGAGAGATCCGTCCAAAGAAGGCGATTTCTCCGTA
TTTTTCTGA

Protein

463 aa

>Os04t0488700-01 AGC kinase, Positive regulation of disease resistance
MAAAAMAPSPPEPALPRELSLGDLRAVSMLGRGAKGVVFHVVPAAAGEEEASMALKAVSR
EAARHKKNGSGGEDGHRRIWFERDVLMSLRHPLLPSLRGVLATDAVVGFAIDRCGGGDLN
SLRRRQTEKMFSDSVIRFYAAELVLALDYLHSLGIVYRDLKPENVLIQDSGHIMLVDFDL
STRLPTPPPPPEEQDATIADSMPEPPPSSPSPNRAKGKRQPGAASCFPFCSVGATKPAAS
ADSPSPTSTSRTASASSSSSSSTATTASSSTAAGVRSPAKSNSFVGTEDYVAPEIIAGSG
HDFSVDWWGLGVVLYEMLYGRTPFRGLNRKETFYRVLSKQPELVGEKTPLRDLIARLLEK
DPEKRIGARGIKAHPFFNGVDWDRILRVARPPFIPPPPEDEDEAGEVLDVEKVVNEVFAA
NDGGAAAGVVEKPSPEAGGTLAVGDGEQRRDPSKEGDFSVFF*

5'UTR

chr04:24418308..24418415 (- strand) : 108 bp

CDS

chr04:24417898..24418307 (- strand) : 410 bp

chr04:24416806..24417784 (- strand) : 979 bp

3'UTR

chr04:24416321..24416805 (- strand) : 485 bp

FASTA

>Os04t0488700-01 class=Sequence position=chr04:24416321..24418415 (- strand)
TCGCGCACCG ACCCCACTCG GATCCTCTCC TCCCCTCCTC ACTGCCTCTC TCCCGTCCAC GAGCGGTTGG TCGATCGATC
GATCGATCGG CGCGGTCCTT CGCCAGCCAT GGCGGCGGCG GCGATGGCGC CCTCGCCTCC GGAGCCGGCG TTGCCGCGGG
AGCTCAGCCT GGGGGACCTC AGGGCGGTGT CCATGCTCGG CCGGggcgcc aagggcgtcg tgttccacgt cgtgcccgcg
gcggcggggg aggaggaggc ctccatggcg ctcaaggcgg tctcgcggga ggcggcgcgg cacaagaaga acgggagcgg
cggcgaggac gggcaccggc ggatctggtt cgagcgggac gtgctcatgt cgctgcgaca cccgctgctc ccctccctcc
gcggcgtcct cgccaccgac gccgtcgtcg ggttcgccat cgaccgctgc ggcggcggag acctcaactc gctccggcgc
cgcCAGACCG AGAAGATGTT CTCCGACTCC GTCATCCGGT ACGCTTCTCG CATCCCCCCC GTTTGGCCAT CGCCGCTTCT
CCGCCACCCA CCCGCGCACG AATGGGTTAA CTAACCACCT CGCCGTTGTT GATTGTTGCT TCTGATTGCA GCTTCTACGC
CGCGGAGTTG GTGCTGGCGC TCGACTATCT GCACAGCCTC GGCATCGTGT ACCGCGACCT CAAGCCGGAG AACGTCCTGA
TACAGGACAG CGGCCACATC ATGCTCGTCG ACTTCGACCT CTCCACGAGG CTCCCGACGC CGCCGCCGCC ACCGGAGGAG
CAGGACGCAA CGATTGCTGA TTCCATGCCG GAGCCTCCGC CCAGTTCACC GTCCCCGAAC CGCGCGAAGG GCAAGAGGCA
ACCGGGGGCG GCCTCGTGCT TCCCGTTCTG TTCGGTCGGC GCCACGAAGC CGGCCGCGTC GGCGGACTCG CCGTCGCCAA
CGTCCACCTC GCGCACGGCC TCGGCGTCGT CCTCGTCCTC ATCCTCGACG GCCACCACCG CGTCGTCCTC CACCGCCGCT
GGCGTGCGGT CGCCAGCGAA GTCGAACTCG TTCGTGGGCA CGGAGGACTA CGTGGCGCCG GAGATCATCG CCGGCAGCGG
GCACGACTTC TCCGTGGACT GGTGGGGCCT GGGCGTGGTG CTCTACGAGA TGCTCTACGG CCGCACGCCG TTCCGGGGGC
TGAACAGGAA GGAGACGTTC TACCGCGTCC TCTCCAAGCA GCCGGAGCTC GTCGGCGAGA AGACGCCGCT GCGCGACCTC
ATCGCCCGCC TCCTGGAGAA GGACCCCGAG AAGCGCATCG GCGCGCGCGG GATCAAGGCG CACCCGTTCT TCAACGGCGT
CGACTGGGAC CGCATCCTCC GCGTGGCGCG CCCGCCGTTC ATCCCGCCCC CGCCGGAGGA CGAGGACGAG GCCGGCGAGG
TGCTCGACGT CGAGAAGGTC GTCAACGAGG TGTTCGCGGC CAATGACGGC GGGGCCGCAG CGGGTGTGGT GGAGAAGCCT
TCGCCGGAGG CAGGTGGAAC TCTGGCCGTC GGCGATGGCG AGCAGAGGAG AGATCCGTCC AAAGAAGGCG ATTTCTCCGT
ATTTTTCTGA GCGTATTTAT TGAGTTCTTT TTTAGCGTTC TCTCTCTTAA AAATGGAAAA TTACATAGCT ATTTTGGTTT
TTTCTATGGA CTAGAATTAT TATGGGGGTC TCTATTAGTA ATAGACATAA TTAAGACAAA GTACGGCGCG GTGGAGTACA
TAAATCGACT TTGCTCTTGT GTTTAATGGA GTACAGTCTG TATAGTATTT TTCCCCTTTC CCTTTTATTT TCTTCTTTGT
TGGATACATT TCCCCGTGCA ACGATGCAAG CTAGGGGATT ACTGAAGAGT GTACATAAGG AATGATGAAC AGCAAAATTG
GCCTAATGTT GTGTCCATCC ATGTGTTCCA TTTCGCTTTG GGTAGCCATT GATGTTAATA CCTGTTACTT CCTTTCAGTG
GGAGTAATAG AAATGGTCAC GGTTTTGTAC ATTTTTCTGC AACATTCTCT CAAAGTAGTA AATGCTTTGA AGTGCCCTTG
CGCCATCAAT GAGGT

Locus: Os04g0488700

Loading...

Locus: Os04g0488700

Loading...