Os04t0488700-02

Locus

Os04g0488700

Description

Similar to protein kinase KIPK.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsOxi1

Oryzabase Gene Name Synonym(s)

AGC Kinase OsOxi1, oxidative signal inducible 1

Transcript Evidence

AK073224 (DDBJ, Best hit)

Protein Evidence

NP_001148148.1 (RefSeq)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

AGC-kinase, C-terminal (IPR000961)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Serine/threonine-protein kinase-like domain (IPR017442)

Full-length cDNA

J033023C18 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0488700-02)

Others

Oryzabase (18114)

Transcript

1463 bp

>Os04t0488700-02 Similar to protein kinase KIPK.
ttcgagcgggacgtgctcatgtcgctgcgacacccgctgctcccctccctccgcggcgtc
ctcgccaccgacgccgtcgtcgggttcgccatcgaccgctgcggcggcggagacctcaac
tcgctccggcgccgcCAGACCGAGAAGATGTTCTCCGACTCCGTCATCCGCTTCTACGCC
GCGGAGTTGGTGCTGGCGCTCGACTATCTGCACAGCCTCGGCATCGTGTACCGCGACCTC
AAGCCGGAGAACGTCCTGATACAGGACAGCGGCCACATCATGCTCGTCGACTTCGACCTC
TCCACGAGGCTCCCGACGCCGCCGCCGCCACCGGAGGAGCAGGACGCAACGATTGCTGAT
TCCATGCCGGAGCCTCCGCCCAGTTCACCGTCCCCGAACCGCGCGAAGGGCAAGAGGCAA
CCGGGGGCGGCCTCGTGCTTCCCGTTCTGTTCGGTCGGCGCCACGAAGCCGGCCGCGTCG
GCGGACTCGCCGTCGCCAACGTCCACCTCGCGCACGGCCTCGGCGTCGTCCTCGTCCTCA
TCCTCGACGGCCACCACCGCGTCGTCCTCCACCGCCGCTGGCGTGCGGTCGCCAGCGAAG
TCGAACTCGTTCGTGGGCACGGAGGACTACGTGGCGCCGGAGATCATCGCCGGCAGCGGG
CACGACTTCTCCGTGGACTGGTGGGGCCTGGGCGTGGTGCTCTACGAGATGCTCTACGGC
CGCACGCCGTTCCGGGGGCTGAACAGGAAGGAGACGTTCTACCGCGTCCTCTCCAAGCAG
CCGGAGCTCGTCGGCGAGAAGACGCCGCTGCGCGACCTCATCGCCCGCCTCCTGGAGAAG
GACCCCGAGAAGCGCATCGGCGCGCGCGGGATCAAGGCGCACCCGTTCTTCAACGGCGTC
GACTGGGACCGCATCCTCCGCGTGGCGCGCCCGCCGTTCATCCCGCCCCCGCCGGAGGAC
GAGGACGAGGCCGGCGAGGTGCTCGACGTCGAGAAGGTCGTCAACGAGGTGTTCGCGGCC
AATGACGGCGGGGCCGCAGCGGGTGTGGTGGAGAAGCCTTCGCCGGAGGCAGGTGGAACT
CTGGCCGTCGGCGATGGCGAGCAGAGGAGAGATCCGTCCAAAGAAGGCGATTTCTCCGTA
TTTTTCTGAGCGTATTTATTGAGTTCTTTTTTAGCGTTCTCTCTCTTAAAAATGGAAAAT
TACATAGCTATTTTGGTTTTTTCTATGGACTAGAATTATTATGGGGGTCTCTATTAGTAA
TAGACATAATTAAGACAAAGTACGGCGCGGTGGAGTACATAAATCGACTTTGCTCTTGTG
TTTAATGGAGTACAGTCTGTATAGTATTTTTCCCCTTTCCCTTTTATTTTCTTCTTTGTT
GGATACATTTCCCCGTGCAACGATGCAAGCTAGGGGATTACTGAAGAGTGTACATAAGGA
ATGATGAACAGCAAAATTGGCCT

CDS

1131 bp

>Os04t0488700-02 Similar to protein kinase KIPK.
atgtcgctgcgacacccgctgctcccctccctccgcggcgtcctcgccaccgacgccgtc
gtcgggttcgccatcgaccgctgcggcggcggagacctcaactcgctccggcgccgcCAG
ACCGAGAAGATGTTCTCCGACTCCGTCATCCGCTTCTACGCCGCGGAGTTGGTGCTGGCG
CTCGACTATCTGCACAGCCTCGGCATCGTGTACCGCGACCTCAAGCCGGAGAACGTCCTG
ATACAGGACAGCGGCCACATCATGCTCGTCGACTTCGACCTCTCCACGAGGCTCCCGACG
CCGCCGCCGCCACCGGAGGAGCAGGACGCAACGATTGCTGATTCCATGCCGGAGCCTCCG
CCCAGTTCACCGTCCCCGAACCGCGCGAAGGGCAAGAGGCAACCGGGGGCGGCCTCGTGC
TTCCCGTTCTGTTCGGTCGGCGCCACGAAGCCGGCCGCGTCGGCGGACTCGCCGTCGCCA
ACGTCCACCTCGCGCACGGCCTCGGCGTCGTCCTCGTCCTCATCCTCGACGGCCACCACC
GCGTCGTCCTCCACCGCCGCTGGCGTGCGGTCGCCAGCGAAGTCGAACTCGTTCGTGGGC
ACGGAGGACTACGTGGCGCCGGAGATCATCGCCGGCAGCGGGCACGACTTCTCCGTGGAC
TGGTGGGGCCTGGGCGTGGTGCTCTACGAGATGCTCTACGGCCGCACGCCGTTCCGGGGG
CTGAACAGGAAGGAGACGTTCTACCGCGTCCTCTCCAAGCAGCCGGAGCTCGTCGGCGAG
AAGACGCCGCTGCGCGACCTCATCGCCCGCCTCCTGGAGAAGGACCCCGAGAAGCGCATC
GGCGCGCGCGGGATCAAGGCGCACCCGTTCTTCAACGGCGTCGACTGGGACCGCATCCTC
CGCGTGGCGCGCCCGCCGTTCATCCCGCCCCCGCCGGAGGACGAGGACGAGGCCGGCGAG
GTGCTCGACGTCGAGAAGGTCGTCAACGAGGTGTTCGCGGCCAATGACGGCGGGGCCGCA
GCGGGTGTGGTGGAGAAGCCTTCGCCGGAGGCAGGTGGAACTCTGGCCGTCGGCGATGGC
GAGCAGAGGAGAGATCCGTCCAAAGAAGGCGATTTCTCCGTATTTTTCTGA

Protein

377 aa

>Os04t0488700-02 Similar to protein kinase KIPK.
MSLRHPLLPSLRGVLATDAVVGFAIDRCGGGDLNSLRRRQTEKMFSDSVIRFYAAELVLA
LDYLHSLGIVYRDLKPENVLIQDSGHIMLVDFDLSTRLPTPPPPPEEQDATIADSMPEPP
PSSPSPNRAKGKRQPGAASCFPFCSVGATKPAASADSPSPTSTSRTASASSSSSSSTATT
ASSSTAAGVRSPAKSNSFVGTEDYVAPEIIAGSGHDFSVDWWGLGVVLYEMLYGRTPFRG
LNRKETFYRVLSKQPELVGEKTPLRDLIARLLEKDPEKRIGARGIKAHPFFNGVDWDRIL
RVARPPFIPPPPEDEDEAGEVLDVEKVVNEVFAANDGGAAAGVVEKPSPEAGGTLAVGDG
EQRRDPSKEGDFSVFF*

5'UTR

chr04:24418050..24418067 (- strand) : 18 bp

CDS

chr04:24417898..24418049 (- strand) : 152 bp

chr04:24416806..24417784 (- strand) : 979 bp

3'UTR

chr04:24416492..24416805 (- strand) : 314 bp

FASTA

>Os04t0488700-02 class=Sequence position=chr04:24416492..24418067 (- strand)
ttcgagcggg acgtgctcat gtcgctgcga cacccgctgc tcccctccct ccgcggcgtc ctcgccaccg acgccgtcgt
cgggttcgcc atcgaccgct gcggcggcgg agacctcaac tcgctccggc gccgcCAGAC CGAGAAGATG TTCTCCGACT
CCGTCATCCG GTACGCTTCT CGCATCCCCC CCGTTTGGCC ATCGCCGCTT CTCCGCCACC CACCCGCGCA CGAATGGGTT
AACTAACCAC CTCGCCGTTG TTGATTGTTG CTTCTGATTG CAGCTTCTAC GCCGCGGAGT TGGTGCTGGC GCTCGACTAT
CTGCACAGCC TCGGCATCGT GTACCGCGAC CTCAAGCCGG AGAACGTCCT GATACAGGAC AGCGGCCACA TCATGCTCGT
CGACTTCGAC CTCTCCACGA GGCTCCCGAC GCCGCCGCCG CCACCGGAGG AGCAGGACGC AACGATTGCT GATTCCATGC
CGGAGCCTCC GCCCAGTTCA CCGTCCCCGA ACCGCGCGAA GGGCAAGAGG CAACCGGGGG CGGCCTCGTG CTTCCCGTTC
TGTTCGGTCG GCGCCACGAA GCCGGCCGCG TCGGCGGACT CGCCGTCGCC AACGTCCACC TCGCGCACGG CCTCGGCGTC
GTCCTCGTCC TCATCCTCGA CGGCCACCAC CGCGTCGTCC TCCACCGCCG CTGGCGTGCG GTCGCCAGCG AAGTCGAACT
CGTTCGTGGG CACGGAGGAC TACGTGGCGC CGGAGATCAT CGCCGGCAGC GGGCACGACT TCTCCGTGGA CTGGTGGGGC
CTGGGCGTGG TGCTCTACGA GATGCTCTAC GGCCGCACGC CGTTCCGGGG GCTGAACAGG AAGGAGACGT TCTACCGCGT
CCTCTCCAAG CAGCCGGAGC TCGTCGGCGA GAAGACGCCG CTGCGCGACC TCATCGCCCG CCTCCTGGAG AAGGACCCCG
AGAAGCGCAT CGGCGCGCGC GGGATCAAGG CGCACCCGTT CTTCAACGGC GTCGACTGGG ACCGCATCCT CCGCGTGGCG
CGCCCGCCGT TCATCCCGCC CCCGCCGGAG GACGAGGACG AGGCCGGCGA GGTGCTCGAC GTCGAGAAGG TCGTCAACGA
GGTGTTCGCG GCCAATGACG GCGGGGCCGC AGCGGGTGTG GTGGAGAAGC CTTCGCCGGA GGCAGGTGGA ACTCTGGCCG
TCGGCGATGG CGAGCAGAGG AGAGATCCGT CCAAAGAAGG CGATTTCTCC GTATTTTTCT GAGCGTATTT ATTGAGTTCT
TTTTTAGCGT TCTCTCTCTT AAAAATGGAA AATTACATAG CTATTTTGGT TTTTTCTATG GACTAGAATT ATTATGGGGG
TCTCTATTAG TAATAGACAT AATTAAGACA AAGTACGGCG CGGTGGAGTA CATAAATCGA CTTTGCTCTT GTGTTTAATG
GAGTACAGTC TGTATAGTAT TTTTCCCCTT TCCCTTTTAT TTTCTTCTTT GTTGGATACA TTTCCCCGTG CAACGATGCA
AGCTAGGGGA TTACTGAAGA GTGTACATAA GGAATGATGA ACAGCAAAAT TGGCCT

Locus: Os04g0488700

Loading...

Locus: Os04g0488700

Loading...