Os04t0493400-01

Locus

Os04g0493400

Description

Class II chitinase b, Pathogenesis-related (PR)-3 chitinase 4

RAP-DB Gene Symbol Synonym(s)

OsChia2b, Cht4

RAP-DB Gene Name Synonym(s)

class II chitinase b, pathogenesis-related (PR)-3 chitinase 4

CGSNL Gene Symbol

CHT4

CGSNL Gene Name

CHITINASE 4

Oryzabase Gene Symbol Synonym(s)

Cht4(t)*(Chi4), Chi4, Cht4, OsChia2b, Chi-4, CHIT2, OsCHIT2, PR3, OsPR3

Oryzabase Gene Name Synonym(s)

Chitinase4, Chitinase IIb, Chitinase 4, Pathogenesis related (PR)-3 chitinase 4, Chitinase-4, PR-3 CLASS IV CHITINASE, Chitinase-4(novel type)

Transcript Evidence

AK060363

AK099973

Protein Evidence

O04138-2

Literature

PMID: 12834284

PMID: 16936841

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

December 20, 2021

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Biological Process: chitin catabolic process (GO:0006032)

Biological Process: cell wall macromolecule catabolic process (GO:0016998)

Molecular Function: chitinase activity (GO:0004568)

Functional domain (InterPro)

Lysozyme-like domain superfamily (IPR023346)

Glycoside hydrolase, family 19 (IPR016283)

Glycoside hydrolase, family 19, catalytic (IPR000726)

Full-length cDNA

001-008-H09 (Online Clone Ordering)

J013128C09 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0493400-01)

Others

Oryzabase (50)

Transcript

1078 bp

>Os04t0493400-01 Class II chitinase b, Pathogenesis-related (PR)-3 chitinase 4
ATCGACCATCACCTCTCCCACACGGGGCGTACGTGCTAAGCTGCAGCACAACCCAAAGCC
ATATATCTCCGATAATGGCGAACTCACCGACGCTGACAATGCTGGTGTTCCTAGCTATTG
GGCTATCTCTCGTCCTCTCCGCAGCCGGCGTGTCTGTGGAGAGCGTGGTCACCGAGGCGT
TCTTCAACGGGATCAAGAACCAGGCCCCGAACGGCTGCGCCGGTAAGAGCTTCTACACAC
GGCAATCGTTCCTGAACGCCGCCCGCTCCTACTCGGGCTTCGCCAATGACCGCACCAACG
ACGACTCCAAGCGCGAGATCGCTGCCTTCTTCGCGCATGTCACACACGAGACTGGACATA
TGTGCTACATCAATGAGATAAATGGGGCAAACATGGACTATTGTGACAAGAGCAACAAAC
AGTGGCCGTGCCAGCCGGGCAAGAAGTACTACGGACGCGGGCCGCTGCAGATCTCATGGA
ACTTCAACTACGGGCCGGCGGGAAAGAACATCGGGTTCGACGGGCTAAGGGACCCAGACA
AGGTGGCGCAGGACCCGACAATCTCTTTCAAGACGGCGCTCTGGTTCTGGATGAACAACG
TGCACCAGGTGATGTCGCAGGGGTTTGGCGCCACCATCCGGGCCATCAACGGTGCGCTCG
AGTGCAACGGGAAGAACCCCGGTGCCGTCAACGCAAGGGTAAACTACTACAAGGACTACT
GCCGCCAGTTCGGCGTCAGCCCGGGGGGCAACCTCTACTGTTGAGTTGCATGCACACGCT
GCTCGGCTCATCGTGATCGACTGAATAATGAACAGAGTAATAATAATGAATAAAACGTTT
GGTGCGTACGTACATTGCATACGTGCACGGTACGTACATGCTGGAAGCTAAGTGACGTCA
AAGAGTTTAGTACTAAAAAGTGATCTTTCTATTCGATGTTACTCTATCTTAGGGCGGAGT
AAGTATAAATGTGTAATAAGAAATAAAATGTTAGGATCGCGGGATCGAAAGATGAGTAAA
CATGTGTACCGGTGGACCACTTAAATAATTATTTCTCCAACCCAAGTACTTTCATGCT

CDS

690 bp

>Os04t0493400-01 Class II chitinase b, Pathogenesis-related (PR)-3 chitinase 4
ATGGCGAACTCACCGACGCTGACAATGCTGGTGTTCCTAGCTATTGGGCTATCTCTCGTC
CTCTCCGCAGCCGGCGTGTCTGTGGAGAGCGTGGTCACCGAGGCGTTCTTCAACGGGATC
AAGAACCAGGCCCCGAACGGCTGCGCCGGTAAGAGCTTCTACACACGGCAATCGTTCCTG
AACGCCGCCCGCTCCTACTCGGGCTTCGCCAATGACCGCACCAACGACGACTCCAAGCGC
GAGATCGCTGCCTTCTTCGCGCATGTCACACACGAGACTGGACATATGTGCTACATCAAT
GAGATAAATGGGGCAAACATGGACTATTGTGACAAGAGCAACAAACAGTGGCCGTGCCAG
CCGGGCAAGAAGTACTACGGACGCGGGCCGCTGCAGATCTCATGGAACTTCAACTACGGG
CCGGCGGGAAAGAACATCGGGTTCGACGGGCTAAGGGACCCAGACAAGGTGGCGCAGGAC
CCGACAATCTCTTTCAAGACGGCGCTCTGGTTCTGGATGAACAACGTGCACCAGGTGATG
TCGCAGGGGTTTGGCGCCACCATCCGGGCCATCAACGGTGCGCTCGAGTGCAACGGGAAG
AACCCCGGTGCCGTCAACGCAAGGGTAAACTACTACAAGGACTACTGCCGCCAGTTCGGC
GTCAGCCCGGGGGGCAACCTCTACTGTTGA

Protein

229 aa

>Os04t0493400-01 Class II chitinase b, Pathogenesis-related (PR)-3 chitinase 4
MANSPTLTMLVFLAIGLSLVLSAAGVSVESVVTEAFFNGIKNQAPNGCAGKSFYTRQSFL
NAARSYSGFANDRTNDDSKREIAAFFAHVTHETGHMCYINEINGANMDYCDKSNKQWPCQ
PGKKYYGRGPLQISWNFNYGPAGKNIGFDGLRDPDKVAQDPTISFKTALWFWMNNVHQVM
SQGFGATIRAINGALECNGKNPGAVNARVNYYKDYCRQFGVSPGGNLYC*

5'UTR

chr04:24689224..24689297 (- strand) : 74 bp

CDS

chr04:24688941..24689223 (- strand) : 283 bp

chr04:24688067..24688473 (- strand) : 407 bp

3'UTR

chr04:24687753..24688066 (- strand) : 314 bp

FASTA

>Os04t0493400-01 class=Sequence position=chr04:24687753..24689297 (- strand)
ATCGACCATC ACCTCTCCCA CACGGGGCGT ACGTGCTAAG CTGCAGCACA ACCCAAAGCC ATATATCTCC GATAATGGCG
AACTCACCGA CGCTGACAAT GCTGGTGTTC CTAGCTATTG GGCTATCTCT CGTCCTCTCC GCAGCCGGCG TGTCTGTGGA
GAGCGTGGTC ACCGAGGCGT TCTTCAACGG GATCAAGAAC CAGGCCCCGA ACGGCTGCGC CGGTAAGAGC TTCTACACAC
GGCAATCGTT CCTGAACGCC GCCCGCTCCT ACTCGGGCTT CGCCAATGAC CGCACCAACG ACGACTCCAA GCGCGAGATC
GCTGCCTTCT TCGCGCATGT CACACACGAG ACTGGACGTA AGCAAAATAT ACTACTCCTA CATGTATATA CCggaaagta
ttttcccgtc gaggagatgt actcttattt cttgcatgtc actagaaaaa aaaattaaca ataaaaattt atactccaca
gtatatatat ttaaattcaa atttggcttt catatgtcga tcgtaacaaa aataataaat ataattgatt aatgtcatat
actagtttca gtttattttt tccgcttaca caagttgaat ttaaccttat atatttgtga atatatttgt gaagtgatat
atttcatact aatatatctt gtcaattttt tttaaaaaaa tagccattta ggtgatttag gtgataaaca agaaacaagg
aatgTTTTCT AGATGGACAA AAGTTAATCT CCTATATGTA CATATAGTAG TATGCATGCG TGTAATTTGG TATGCAACTA
ACGATGATGA TAATTCACTG GCAGATATGT GCTACATCAA TGAGATAAAT GGGGCAAACA TGGACTATTG TGACAAGAGC
AACAAACAGT GGCCGTGCCA GCCGGGCAAG AAGTACTACG GACGCGGGCC GCTGCAGATC TCATGGAACT TCAACTACGG
GCCGGCGGGA AAGAACATCG GGTTCGACGG GCTAAGGGAC CCAGACAAGG TGGCGCAGGA CCCGACAATC TCTTTCAAGA
CGGCGCTCTG GTTCTGGATG AACAACGTGC ACCAGGTGAT GTCGCAGGGG TTTGGCGCCA CCATCCGGGC CATCAACGGT
GCGCTCGAGT GCAACGGGAA GAACCCCGGT GCCGTCAACG CAAGGGTAAA CTACTACAAG GACTACTGCC GCCAGTTCGG
CGTCAGCCCG GGGGGCAACC TCTACTGTTG AGTTGCATGC ACACGCTGCT CGGCTCATCG TGATCGACTG AATAATGAAC
AGAGTAATAA TAATGAATAA AACGTTTGGT GCGTACGTAC ATTGCATACG TGCACGGTAC GTACATGCTG GAAGCTAAGT
GACGTCAAAG AGTTTAGTAC TAAAAAGTGA TCTTTCTATT CGATGTTACT CTATCTTAGG GCGGAGTAAG TATAAATGTG
TAATAAGAAA TAAAATGTTA GGATCGCGGG ATCGAAAGAT GAGTAAACAT GTGTACCGGT GGACCACTTA AATAATTATT
TCTCCAACCC AAGTACTTTC ATGCT

Locus: Os04g0493400

Loading...

Locus: Os04g0493400

Loading...