Os04t0497200-01

Locus

Os04g0497200

Description

Putative membrane-bound endo-1,4-beta-glucanase, Synthesis of root cellulose, Modulation of root cell division and elongation

RAP-DB Gene Symbol Synonym(s)

OsGLU3

RAP-DB Gene Name Synonym(s)

"endo-1,4-β-glucanase 3", "endo-1,4-beta-glucanase 3"

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsGLU3, OsGH9A2, GLU3, GH9A2

Oryzabase Gene Name Synonym(s)

endo-1, 4-b-D-glucanase 3, glycoside hydrolase OsGH9A2, glycoside hydrolase 9A2

Transcript Evidence

AK243593

Protein Evidence

Q7XUK4

Literature

PMID: 21976713

Note

Manual Curation

March 14, 2017

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Functional domain (InterPro)

Glycoside hydrolase family 9 (IPR001701)

Six-hairpin glycosidase-like (IPR008928)

Glycoside hydrolase family 9, His active site (IPR018221)

Glycosyl hydrolases family 9, Asp/Glu active sites (IPR033126)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

endosome (GO:0005768)

Full-length cDNA

J100084A19 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0497200-01)

Others

Oryzabase (10530)

KEGG (Os04t0497200-01 (EC:3.2.1.4))

Transcript

2268 bp

>Os04t0497200-01 Putative membrane-bound endo-1,4-beta-glucanase, Synthesis of root cellulose, Modulation of root cell division and elongation
GCCACCACCGCCCCAAGAATAGCACCCGCGTTTCATGCGCTGATCGACCGATCGACCCAC
CAGCTAAGCCACCCGCAGCCGCGGGGCGAGCCAAGCCCACCGCCGCAGCCGCAGCCACAG
CCATGTACTCGGCGAACCACTGGGGCGGGTCGTTCGAGATCGCCGCGGACGGCGCGGCGG
AGGATGACCACAGCCGCAACATGGACCTGGACCGCGGCGCGCTGTCGGCGCGGCAGCACC
AGCTGGACGAGACGCAGCAGAGCTGGCTGCTCGGCCCGCCGGAGGCCAAGAAGAAGGACA
AGTACGTCGACCTCGGCTGCGTCGTCGTCAAGCGCAAGCTCCTCTGGTGGGTCCTCTGGA
CCCTCCTCGCCGCCTTCATCCTCATCGGCCTCCCCGTCATCATCGCCAAGTCCATCCCCA
AGAAGAAGCCCCACGCCCCTCCCCCCGACCAGTACACCGACGCCCTCCACAAGGCCCTCC
TCTTCTTCAACGCCCAGAAATCCGGCCGGCTCCCGAAGAACAACGGCATCAAATGGCGCG
GCAACTCCGGCCTGTCGGATGGCTCCGATCTGACGGACGTCAAGGGCGGGCTCGTCGGCG
GCTACTACGACGCCGGCGACAACATCAAGTTCCATTTCCCCTTGGCCTTCTCCATGACAA
TGCTCAGCTGGTCAGTGATCGAGTACAGCGCCAAGTACAAGGCGGTAGGGGAGTATGACC
ATGTGAGGGAGCTCATCAAGTGGGGCACCGACTACCTGCTCCTCACCTTCAACTCCTCTG
CTTCCACCATTGACAAAGTCTATAGCCAGGTGGGCATTGCGAAGATCAACGGCACCCAGC
CGGACGACCACTACTGCTGGAACCGGCCGGAGGACATGGCGTACCCACGCCCCGTCCAGA
CGGCCGGCTCGGCGCCGGACCTCGGCGGCGAGATGGCGGCGGCGCTCGCGGCGGCCTCCA
TCGTGTTCCGCGACAACGCCGCCTACTCCAAGAAGCTCGTGAACGGCGCGGCCGCCGTGT
ACAAGTTCGCGCGCAGCAGCGGCCGCCGCACCCCGTACTCCCGCGGCAACCAGTACATCG
AGTACTACTACAACTCCACCAGCTACTGGGACGAGTACATGTGGAGCGCGGCGTGGATGT
ACTACGCCACGGGGAACAACACCTACATCACCTTCGCCACCGACCCGCGGCTGCCCAAGA
ACGCCAAGGCCTTCTACAGCATCCTCGACTTCTCCGTCTTCAGCTGGGACAACAAGCTGC
CGGGCGCCGAGCTGCTGCTGTCGCGGCTCCGCATGTTCCTCAACCCGGGTTACCCCTACG
AGGAGTCGCTCATCGGGTACCACAACACCACCAGCATGAACATGTGCACCTACTTCCCGC
GCTTCGGCGCCTTCAACTTCACCAAGGGTGGGCTCGCGCAGTTCAACCACGGGAAGGGCC
AGCCGCTGCAGTACACCGTCGCCAACTCCTTCCTCGCCGCGCTCTACGCCGACTACATGG
AGTCCGTCAACGTCCCCGGCTGGTACTGCGGCCCCTACTTCATGACCGTCGACGATCTCC
GCTCCTTCGCCAGGTCTCAGGTGAACTACATTCTTGGGGATAACCCGAAGAAGATGAGCT
ACGTGGTGGGGTACGGCAAGAAGTACCCGCGGCGGCTGCACCACAGGGGGGCGTCGACGC
CGCACAACGGCATCAAGTACTCGTGCACCGGCGGGTACAAGTGGAGGGACACCAAGGGGG
CCGACCCGAACGTGCTCGTCGGCGCCATGGTCGGCGGGCCGGACAAGAACGACCAGTTCA
AGGACGCGCGCCTCACCTACGCGCAGAACGAGCCGACGTTGGTGGGCAACGCCGGCCTCG
TGGCCGCCCTCGTCGCCCTCACCAACAGCGGCCGCGGCGCGGGCGTCACCGCCGTCGACA
AGAACACCATGTTCTCCGCCGTGCCGCCCATGTTCCCGGCCACGCCGCCGCCGCCGTCCA
AGTGGAAGCCGTGAGAGAGAATTCAATCCAACCGGCCGGCCAAGTACATCGCCGTGCCTA
GTGGTTCCGAAGGTGTTTGATTAGATCAACGAGGTGTTTCGGTTCGTTTGGTCATACAGT
TTTTGGTGATCACGCAATTCTTTTGTATTATACACGTTAACTTCGGCAAAATCGATACTG
TGGATGATGGAATGCTTTATGCATGACCTGTAGATGAAAGATGTTTTCTTCATATAAATT
ATGATCACGGTGGATGAATCAACAGATGTGATTACAAATAGGCTGCAA

CDS

1872 bp

>Os04t0497200-01 Putative membrane-bound endo-1,4-beta-glucanase, Synthesis of root cellulose, Modulation of root cell division and elongation
ATGTACTCGGCGAACCACTGGGGCGGGTCGTTCGAGATCGCCGCGGACGGCGCGGCGGAG
GATGACCACAGCCGCAACATGGACCTGGACCGCGGCGCGCTGTCGGCGCGGCAGCACCAG
CTGGACGAGACGCAGCAGAGCTGGCTGCTCGGCCCGCCGGAGGCCAAGAAGAAGGACAAG
TACGTCGACCTCGGCTGCGTCGTCGTCAAGCGCAAGCTCCTCTGGTGGGTCCTCTGGACC
CTCCTCGCCGCCTTCATCCTCATCGGCCTCCCCGTCATCATCGCCAAGTCCATCCCCAAG
AAGAAGCCCCACGCCCCTCCCCCCGACCAGTACACCGACGCCCTCCACAAGGCCCTCCTC
TTCTTCAACGCCCAGAAATCCGGCCGGCTCCCGAAGAACAACGGCATCAAATGGCGCGGC
AACTCCGGCCTGTCGGATGGCTCCGATCTGACGGACGTCAAGGGCGGGCTCGTCGGCGGC
TACTACGACGCCGGCGACAACATCAAGTTCCATTTCCCCTTGGCCTTCTCCATGACAATG
CTCAGCTGGTCAGTGATCGAGTACAGCGCCAAGTACAAGGCGGTAGGGGAGTATGACCAT
GTGAGGGAGCTCATCAAGTGGGGCACCGACTACCTGCTCCTCACCTTCAACTCCTCTGCT
TCCACCATTGACAAAGTCTATAGCCAGGTGGGCATTGCGAAGATCAACGGCACCCAGCCG
GACGACCACTACTGCTGGAACCGGCCGGAGGACATGGCGTACCCACGCCCCGTCCAGACG
GCCGGCTCGGCGCCGGACCTCGGCGGCGAGATGGCGGCGGCGCTCGCGGCGGCCTCCATC
GTGTTCCGCGACAACGCCGCCTACTCCAAGAAGCTCGTGAACGGCGCGGCCGCCGTGTAC
AAGTTCGCGCGCAGCAGCGGCCGCCGCACCCCGTACTCCCGCGGCAACCAGTACATCGAG
TACTACTACAACTCCACCAGCTACTGGGACGAGTACATGTGGAGCGCGGCGTGGATGTAC
TACGCCACGGGGAACAACACCTACATCACCTTCGCCACCGACCCGCGGCTGCCCAAGAAC
GCCAAGGCCTTCTACAGCATCCTCGACTTCTCCGTCTTCAGCTGGGACAACAAGCTGCCG
GGCGCCGAGCTGCTGCTGTCGCGGCTCCGCATGTTCCTCAACCCGGGTTACCCCTACGAG
GAGTCGCTCATCGGGTACCACAACACCACCAGCATGAACATGTGCACCTACTTCCCGCGC
TTCGGCGCCTTCAACTTCACCAAGGGTGGGCTCGCGCAGTTCAACCACGGGAAGGGCCAG
CCGCTGCAGTACACCGTCGCCAACTCCTTCCTCGCCGCGCTCTACGCCGACTACATGGAG
TCCGTCAACGTCCCCGGCTGGTACTGCGGCCCCTACTTCATGACCGTCGACGATCTCCGC
TCCTTCGCCAGGTCTCAGGTGAACTACATTCTTGGGGATAACCCGAAGAAGATGAGCTAC
GTGGTGGGGTACGGCAAGAAGTACCCGCGGCGGCTGCACCACAGGGGGGCGTCGACGCCG
CACAACGGCATCAAGTACTCGTGCACCGGCGGGTACAAGTGGAGGGACACCAAGGGGGCC
GACCCGAACGTGCTCGTCGGCGCCATGGTCGGCGGGCCGGACAAGAACGACCAGTTCAAG
GACGCGCGCCTCACCTACGCGCAGAACGAGCCGACGTTGGTGGGCAACGCCGGCCTCGTG
GCCGCCCTCGTCGCCCTCACCAACAGCGGCCGCGGCGCGGGCGTCACCGCCGTCGACAAG
AACACCATGTTCTCCGCCGTGCCGCCCATGTTCCCGGCCACGCCGCCGCCGCCGTCCAAG
TGGAAGCCGTGA

Protein

624 aa

>Os04t0497200-01 Putative membrane-bound endo-1,4-beta-glucanase, Synthesis of root cellulose, Modulation of root cell division and elongation
MYSANHWGGSFEIAADGAAEDDHSRNMDLDRGALSARQHQLDETQQSWLLGPPEAKKKDK
YVDLGCVVVKRKLLWWVLWTLLAAFILIGLPVIIAKSIPKKKPHAPPPDQYTDALHKALL
FFNAQKSGRLPKNNGIKWRGNSGLSDGSDLTDVKGGLVGGYYDAGDNIKFHFPLAFSMTM
LSWSVIEYSAKYKAVGEYDHVRELIKWGTDYLLLTFNSSASTIDKVYSQVGIAKINGTQP
DDHYCWNRPEDMAYPRPVQTAGSAPDLGGEMAAALAAASIVFRDNAAYSKKLVNGAAAVY
KFARSSGRRTPYSRGNQYIEYYYNSTSYWDEYMWSAAWMYYATGNNTYITFATDPRLPKN
AKAFYSILDFSVFSWDNKLPGAELLLSRLRMFLNPGYPYEESLIGYHNTTSMNMCTYFPR
FGAFNFTKGGLAQFNHGKGQPLQYTVANSFLAALYADYMESVNVPGWYCGPYFMTVDDLR
SFARSQVNYILGDNPKKMSYVVGYGKKYPRRLHHRGASTPHNGIKYSCTGGYKWRDTKGA
DPNVLVGAMVGGPDKNDQFKDARLTYAQNEPTLVGNAGLVAALVALTNSGRGAGVTAVDK
NTMFSAVPPMFPATPPPPSKWKP*

5'UTR

chr04:24867594..24867715 (- strand) : 122 bp

CDS

chr04:24867215..24867593 (- strand) : 379 bp

chr04:24866132..24866439 (- strand) : 308 bp

chr04:24864772..24865542 (- strand) : 771 bp

chr04:24864268..24864681 (- strand) : 414 bp

3'UTR

chr04:24863994..24864267 (- strand) : 274 bp

FASTA

>Os04t0497200-01 class=Sequence position=chr04:24863994..24867715 (- strand)
GCCACCACCG CCCCAAGAAT AGCACCCGCG TTTCATGCGC TGATCGACCG ATCGACCCAC CAGCTAAGCC ACCCGCAGCC
GCGGGGCGAG CCAAGCCCAC CGCCGCAGCC GCAGCCACAG CCATGTACTC GGCGAACCAC TGGGGCGGGT CGTTCGAGAT
CGCCGCGGAC GGCGCGGCGG AGGATGACCA CAGCCGCAAC ATGGACCTGG ACCGCGGCGC GCTGTCGGCG CGGCAGCACC
AGCTGGACGA GACGCAGCAG AGCTGGCTGC TCGGCCCGCC GGAGGCCAAG AAGAAGGACA AGTACGTCGA CCTCGGCTGC
GTCGTCGTCA AGCGCAAGCT CCTCTGGTGG GTCCTCTGGA CCCTCCTCGC CGCCTTCATC CTCATCGGCC TCCCCGTCAT
CATCGCCAAG TCCATCCCCA AGAAGAAGCC CCACGCCCCT CCCCCCGACC AGTACACCGA CGCCCTCCAC AAGGCCCTCC
TCTTCTTCAA CGCCCAGAAA TGTCAGTCCC CCCTCCATCC TGTGATATGA TCCTCTGTTT GTGCGTTAGT TAATTAACTA
ACTAGGATGG AAACCTTTGC CAAAACAAGA ATCTTTTGAC TTTGATCAGT AGAGATCTCA TCGCATTTGC CATTTGTGTT
AGAGCTTCTG AATCTGCAGA CGGATTTGCT CAAAATGAGT AGAAGTATGT TGCCTTGAAT TTCCTTAGGT TTACTGAGTT
TTGAACTTTT GACCCGTGAT ATTAGCTGCA TGATTATGTG TTGATCCCGA GGAGAGAGGA TCGAGCAAGT ACAAATCTAC
AGGCGAGTAG TAGCACTAGT TAGTTTTAAT CAGTTCAGTT GAGCTGTGCA CAACTGCAAC CCCACAAATG GAATGTTCTG
TGCTACTGTT CATAGTCCCA CAGCTTTGAA GAAAGTGACA CTCTGATGTG GAGAGAAATC TCCCAAAAAT CCAGCTGCGC
TTTGGCTTGG AGTCTTGGCA ATTTGGCGTC TCACGCACGT TCGTGCACAT GTAGGACAGC CAATTGATCC ATTCTTTAAC
GCGGCACGAA GTACTCCTCT GCAATACTAG TGTACCTGTA GATCTCGCCG CATGATCTGC TTCTGGATCT TGACAGATAC
TCTGCACTTG TAGATCTTGA GCTTACACTA CAGTACTACT AGTCATCCGA TTCTGACTTC CATGCTCAAA ATTCAGTTTG
AAACGTGCAC TGATGAATGC AGCCCTTCTT TCTCTGACGA ACAATTTTGG CCATGTCTCG TTCTCTGCTC TGACAGCCGG
CCGGCTCCCG AAGAACAACG GCATCAAATG GCGCGGCAAC TCCGGCCTGT CGGATGGCTC CGATCTGACG GACGTCAAGG
GCGGGCTCGT CGGCGGCTAC TACGACGCCG GCGACAACAT CAAGTTCCAT TTCCCCTTGG CCTTCTCCAT GACAATGCTC
AGCTGGTCAG TGATCGAGTA CAGCGCCAAG TACAAGGCGG TAGGGGAGTA TGACCATGTG AGGGAGCTCA TCAAGTGGGG
CACCGACTAC CTGCTCCTCA CCTTCAACTC CTCTGCTTCC ACCATTGACA AAGTCTATAG CCAGGTACTT GCTCAAAGTC
CCAATTCTGA ATATATTTCA TTATGAATCT TGGAAGAAAT ATTTGATCTG TGAAAATTTT GGTGCATTGT TACTATCTTG
GTTCTTTTCT GCTGTAATCA TAGCTGGAAG ACCGTAGAAT TTATAAATGC AGAGAAGCAT ACTGTTTCTT ACTACAGCAG
TAAAGTAAGT TTCTGAAATA AGGTCGTAGT GAGCAAACTG GTCAGTTCTG TCAATTACAG TATTACATGC CGAGCAATCT
ATTCCATCAG TAATTGATTG GCACGCCTAA CAACCTTTGA CTCTTATCAC ATGGGCTCCA GTAGAATAAG GTTCATCATC
CAATCATCTG CATGTGCTGA ACAATAATAT AATTAAAACT TAGGAGTGGT CGATCTGTCT CGATCTCTCA GAACTACATT
TTGGCATACA ATGAAAGATG CAGTGGTAAA ACTTTGATTC ACATTCTCTT ACTCTGGGTT GATCCACCAG GAAAATTATG
TAAAAACATT TGAAGTTATC AGTATTAAGT GAAAAAGAAA ATGATGTCAA ATCAAGCATA CTAGGTCTGA ACGGTGCATG
CATGCTCCTG CAGGTGGGCA TTGCGAAGAT CAACGGCACC CAGCCGGACG ACCACTACTG CTGGAACCGG CCGGAGGACA
TGGCGTACCC ACGCCCCGTC CAGACGGCCG GCTCGGCGCC GGACCTCGGC GGCGAGATGG CGGCGGCGCT CGCGGCGGCC
TCCATCGTGT TCCGCGACAA CGCCGCCTAC TCCAAGAAGC TCGTGAACGG CGCGGCCGCC GTGTACAAGT TCGCGCGCAG
CAGCGGCCGC CGCACCCCGT ACTCCCGCGG CAACCAGTAC ATCGAGTACT ACTACAACTC CACCAGCTAC TGGGACGAGT
ACATGTGGAG CGCGGCGTGG ATGTACTACG CCACGGGGAA CAACACCTAC ATCACCTTCG CCACCGACCC GCGGCTGCCC
AAGAACGCCA AGGCCTTCTA CAGCATCCTC GACTTCTCCG TCTTCAGCTG GGACAACAAG CTGCCGGGCG CCGAGCTGCT
GCTGTCGCGG CTCCGCATGT TCCTCAACCC GGGTTACCCC TACGAGGAGT CGCTCATCGG GTACCACAAC ACCACCAGCA
TGAACATGTG CACCTACTTC CCGCGCTTCG GCGCCTTCAA CTTCACCAAG GGTGGGCTCG CGCAGTTCAA CCACGGGAAG
GGCCAGCCGC TGCAGTACAC CGTCGCCAAC TCCTTCCTCG CCGCGCTCTA CGCCGACTAC ATGGAGTCCG TCAACGTCCC
CGGCTGGTAC TGCGGCCCCT ACTTCATGAC CGTCGACGAT CTCCGCTCCT TCGCCAGGTC TCAGGTACGT GTAATCGACG
ATCGATCACA GATTTTCACA ATGCATGCAT CAATTGGAAG TTGTTTTGCT GACGACGGCG ATGTACATGT GCAGGTGAAC
TACATTCTTG GGGATAACCC GAAGAAGATG AGCTACGTGG TGGGGTACGG CAAGAAGTAC CCGCGGCGGC TGCACCACAG
GGGGGCGTCG ACGCCGCACA ACGGCATCAA GTACTCGTGC ACCGGCGGGT ACAAGTGGAG GGACACCAAG GGGGCCGACC
CGAACGTGCT CGTCGGCGCC ATGGTCGGCG GGCCGGACAA GAACGACCAG TTCAAGGACG CGCGCCTCAC CTACGCGCAG
AACGAGCCGA CGTTGGTGGG CAACGCCGGC CTCGTGGCCG CCCTCGTCGC CCTCACCAAC AGCGGCCGCG GCGCGGGCGT
CACCGCCGTC GACAAGAACA CCATGTTCTC CGCCGTGCCG CCCATGTTCC CGGCCACGCC GCCGCCGCCG TCCAAGTGGA
AGCCGTGAGA GAGAATTCAA TCCAACCGGC CGGCCAAGTA CATCGCCGTG CCTAGTGGTT CCGAAGGTGT TTGATTAGAT
CAACGAGGTG TTTCGGTTCG TTTGGTCATA CAGTTTTTGG TGATCACGCA ATTCTTTTGT ATTATACACG TTAACTTCGG
CAAAATCGAT ACTGTGGATG ATGGAATGCT TTATGCATGA CCTGTAGATG AAAGATGTTT TCTTCATATA AATTATGATC
ACGGTGGATG AATCAACAGA TGTGATTACA AATAGGCTGC AA

Locus: Os04g0497200

Loading...

Locus: Os04g0497200

Loading...