Os04t0500700-01

Locus

Os04g0500700

Description

Similar to Hydroxyanthranilate hydroxycinnamoyltransferase 3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HCT1

CGSNL Gene Name

HYDROXYCINNAMOYLTRANSFERASE 1

Oryzabase Gene Symbol Synonym(s)

OsHCT1

Oryzabase Gene Name Synonym(s)

Hydroxycinnamoyltransferase 1, hydroxycinnamoyl CoA:shikimate/quinate hydroxycinnamoyl transferase 1

Transcript Evidence

AK119237 (DDBJ, Best hit)

Protein Evidence

B6UCS8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Functional domain (InterPro)

Transferase (IPR003480)

Chloramphenicol acetyltransferase-like domain (IPR023213)

Full-length cDNA

001-116-D12 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0500700-01)

RiceXPro (AK119237)

Others

Oryzabase (10356)

KEGG (Os04t0500700-01)

Transcript

1827 bp

>Os04t0500700-01 Similar to Hydroxyanthranilate hydroxycinnamoyltransferase 3.
ACGCCTACGCGAGCTCGGAGCTCAGCTCTACCGCCCCCGCACGCCGCCGCCGCCCGTCGC
CTATAAAAGCCGCTCCACCCCCAACGAGCCCACCAGCTGCTCTCCACCAAGAGCTGCTCC
GCCCCCCTACCCCGCAACCCGTTGCTTTGTGCCGCGCCTCGCTTTGGTCTTCATCCGCCT
CAGATCTGATTCGTTCTAGGTTGGTCTGGGGAAGATGGCGATCACGGTGAGGCGGTCGAC
GATGGTGCGGCCGGCGTGGGAGACGCCGCGGGTGCGGCTGTGGAACTCGAACCTCGACCT
CGTGGTGCCGCGGTTCCACACCCCAAGCGTCTACTTCTACCGCCGGGGCCCCGAGGGAGG
GGGCGCGCCGGAGGGGTTCTTCGACGGGGAGCGGATGCGGCGCGCGCTGGCGGAGGCGCT
CGTGCCGTTCTACCCGATGGCCGGGCGGCTCGCGCGCGACGAGGACGGGAGGGTCGAGAT
CGACTGCAACGGGGAAGGGGTGCTCTTCGTCGAGGCCGACGCGCCCGACGCCTCCGTCGA
TGACTACGGCGACTTCGCGCCCACCATGGAGCTCAAGCGCCTCATCCCTGCCGTTGATTA
CACCGACGACATCTCCTCCTTCTCGCTCCTCGTGCTCCAGGTGACCTACTTCAAGTGCGG
AGGTGTCTCCCTTGGAGTTGGTATGCAACACCATGTGGCGGATGGCATGTCCGGTTTGCA
CTTTATTAACTCATGGTCTGACCTCTGCCGAGGAACTCAAATTGCCATCATGCCCTTCAT
TGACCGCACTCTCCTACGAGCCCGAGATCCACCAACTCCATCATACCCACATGTTGAGTA
CCAGCCTGCCCCAGCCATGCTGTCCTCCGTACCCCAGTCTGTTACTGCTAATAAGACAAC
ACCACCTCCAACTGCTGTGGACATTTTCAAGCTTACCCGCTCAGACCTTGGTCGACTGCG
TTCGCAGCTCCCATCAGGAGAAGGTGCACCACGTTTCAGCACATATGCAGTTCTTGCTGC
ACATGTCTGGCGATGCGTATCTCTTGCACGTGGCCTGCCTTCTGAACAGCCCACTAAGCT
GTATTGTGCCACTGATGGGCGACAACGGTTGCAGCCTCCACTTCCAGAAGGTTACTTTGG
GAATGTCATTTTCACCGCCACTCCACTTGCTGAGGCAGGCAAGGTGACCAGTGGGCTGGC
AGATGGAGCAGCAGTcatccaagaggcgctagataggatgaacgatagctactgccgctc
agcattggactacctggagctgcagcctgatttatcagcattggtccgtggagcacacac
tttccggtgtccgaacctcgggctcaccagctgggtgcgcttgccaattcatgatgcaga
ttttggatggggaagaccagtgttcatgGGTCCTGGTGGCATCGCCTATGAAGGGCTGGC
GTTTGTCCTCCCAAGCGCGAACAAGGATGGTAGCCTATCCATAGCCATCTCATTGCAGGC
TGAGCACATGGAGAAGTTCAGGAAGCTGATCTTCGAGGTGTAAGCAGACTACTTATGTTA
TGTCAGGGAGAAGTTGTAGAGCTAGAGTTCTCAGGTAAAATACCTTCAAGTGAGTCATGG
GGGCTATGCTCTTGCTCCTGTTGAGCAAATTGTCTGGCCACGTTCTCTTGTACCTTAGCT
TGCAAGGATATTTGGCCATCACCACAGCCGTGTGACGATGTGAGCAACCAATAATGAGCT
GTTTTTTTGTTTTCGTTTAGGATAGGAATCAACAATGAAGAAAAGGTGCTGTATTCTGTG
AAACTACATGGCAGTGTTGTTCTTACC

CDS

1329 bp

>Os04t0500700-01 Similar to Hydroxyanthranilate hydroxycinnamoyltransferase 3.
ATGGCGATCACGGTGAGGCGGTCGACGATGGTGCGGCCGGCGTGGGAGACGCCGCGGGTG
CGGCTGTGGAACTCGAACCTCGACCTCGTGGTGCCGCGGTTCCACACCCCAAGCGTCTAC
TTCTACCGCCGGGGCCCCGAGGGAGGGGGCGCGCCGGAGGGGTTCTTCGACGGGGAGCGG
ATGCGGCGCGCGCTGGCGGAGGCGCTCGTGCCGTTCTACCCGATGGCCGGGCGGCTCGCG
CGCGACGAGGACGGGAGGGTCGAGATCGACTGCAACGGGGAAGGGGTGCTCTTCGTCGAG
GCCGACGCGCCCGACGCCTCCGTCGATGACTACGGCGACTTCGCGCCCACCATGGAGCTC
AAGCGCCTCATCCCTGCCGTTGATTACACCGACGACATCTCCTCCTTCTCGCTCCTCGTG
CTCCAGGTGACCTACTTCAAGTGCGGAGGTGTCTCCCTTGGAGTTGGTATGCAACACCAT
GTGGCGGATGGCATGTCCGGTTTGCACTTTATTAACTCATGGTCTGACCTCTGCCGAGGA
ACTCAAATTGCCATCATGCCCTTCATTGACCGCACTCTCCTACGAGCCCGAGATCCACCA
ACTCCATCATACCCACATGTTGAGTACCAGCCTGCCCCAGCCATGCTGTCCTCCGTACCC
CAGTCTGTTACTGCTAATAAGACAACACCACCTCCAACTGCTGTGGACATTTTCAAGCTT
ACCCGCTCAGACCTTGGTCGACTGCGTTCGCAGCTCCCATCAGGAGAAGGTGCACCACGT
TTCAGCACATATGCAGTTCTTGCTGCACATGTCTGGCGATGCGTATCTCTTGCACGTGGC
CTGCCTTCTGAACAGCCCACTAAGCTGTATTGTGCCACTGATGGGCGACAACGGTTGCAG
CCTCCACTTCCAGAAGGTTACTTTGGGAATGTCATTTTCACCGCCACTCCACTTGCTGAG
GCAGGCAAGGTGACCAGTGGGCTGGCAGATGGAGCAGCAGTcatccaagaggcgctagat
aggatgaacgatagctactgccgctcagcattggactacctggagctgcagcctgattta
tcagcattggtccgtggagcacacactttccggtgtccgaacctcgggctcaccagctgg
gtgcgcttgccaattcatgatgcagattttggatggggaagaccagtgttcatgGGTCCT
GGTGGCATCGCCTATGAAGGGCTGGCGTTTGTCCTCCCAAGCGCGAACAAGGATGGTAGC
CTATCCATAGCCATCTCATTGCAGGCTGAGCACATGGAGAAGTTCAGGAAGCTGATCTTC
GAGGTGTAA

Protein

443 aa

>Os04t0500700-01 Similar to Hydroxyanthranilate hydroxycinnamoyltransferase 3.
MAITVRRSTMVRPAWETPRVRLWNSNLDLVVPRFHTPSVYFYRRGPEGGGAPEGFFDGER
MRRALAEALVPFYPMAGRLARDEDGRVEIDCNGEGVLFVEADAPDASVDDYGDFAPTMEL
KRLIPAVDYTDDISSFSLLVLQVTYFKCGGVSLGVGMQHHVADGMSGLHFINSWSDLCRG
TQIAIMPFIDRTLLRARDPPTPSYPHVEYQPAPAMLSSVPQSVTANKTTPPPTAVDIFKL
TRSDLGRLRSQLPSGEGAPRFSTYAVLAAHVWRCVSLARGLPSEQPTKLYCATDGRQRLQ
PPLPEGYFGNVIFTATPLAEAGKVTSGLADGAAVIQEALDRMNDSYCRSALDYLELQPDL
SALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANKDGS
LSIAISLQAEHMEKFRKLIFEV*

5'UTR

chr04:24993910..24994117 (+ strand) : 208 bp

chr04:24994235..24994240 (+ strand) : 6 bp

CDS

chr04:24994241..24994666 (+ strand) : 426 bp

chr04:24998197..24999099 (+ strand) : 903 bp

3'UTR

chr04:24999100..24999383 (+ strand) : 284 bp

FASTA

>Os04t0500700-01 class=Sequence position=chr04:24993910..24999383 (+ strand)
ACGCCTACGC GAGCTCGGAG CTCAGCTCTA CCGCCCCCGC ACGCCGCCGC CGCCCGTCGC CTATAAAAGC CGCTCCACCC
CCAACGAGCC CACCAGCTGC TCTCCACCAA GAGCTGCTCC GCCCCCCTAC CCCGCAACCC GTTGCTTTGT GCCGCGCCTC
GCTTTGGTCT TCATCCGCCT CAGATCTGAT TCGTTCTAGG TTGGTCTGGT GAGTGGTGCT TGGCGTTTTT GTTTTTTGTT
TTTTTTTTGT TTTCGTGTGT GAGGGGATTG GGATGCTCAC GAGGTGTTTG GTGGTATGCG TGGGCGGCGG CGGCGGCGGT
GGCAGGGGAA GATGGCGATC ACGGTGAGGC GGTCGACGAT GGTGCGGCCG GCGTGGGAGA CGCCGCGGGT GCGGCTGTGG
AACTCGAACC TCGACCTCGT GGTGCCGCGG TTCCACACCC CAAGCGTCTA CTTCTACCGC CGGGGCCCCG AGGGAGGGGG
CGCGCCGGAG GGGTTCTTCG ACGGGGAGCG GATGCGGCGC GCGCTGGCGG AGGCGCTCGT GCCGTTCTAC CCGATGGCCG
GGCGGCTCGC GCGCGACGAG GACGGGAGGG TCGAGATCGA CTGCAACGGG GAAGGGGTGC TCTTCGTCGA GGCCGACGCG
CCCGACGCCT CCGTCGATGA CTACGGCGAC TTCGCGCCCA CCATGGAGCT CAAGCGCCTC ATCCCTGCCG TTGATTACAC
CGACGACATC TCCTCCTTCT CGCTCCTCGT GCTCCAGGTG AGCTCCAAAT TTCTAGTAGC AAGTACAGTT AGATCCAAGC
ACAAAATCAA ACGAGGTTAG AGATAGCTTT CTGGAAGTGG AGCGCAAACA ATGCTTTGCA ACTGCAGCTG ACAACTAAGT
TTGGCAGTAA GCCATTAATT ATAACATTTT GGGGCTGATT GTATAGCTAG GTCCCATGTT GGCTGTTGCA CTAAATGTTT
GGGGCTGAGC TTAGCGGGTC ACCTACTCTT TGGTTGGCTT TAATTAGCTG CATCAGATGT ACGGTTCCAT CCAGGCAGTT
GATGTCTTTC TGTTGTGGGC GGGGTCTATT TTTGGTTTGA TGTTTATGCT TATTGTGATA GTTTAGTAGG GGTTGTGTAG
GAATTATAGA ATTTTAAAAC ACCATAATTC AATGCCAATA ATCAGTATCC ACTAAAAAAA TGAAGTATAT GCTTCACCTT
GACTGTGTCA AAGCCTAGAC AATTTTGATT TGTCCAGAGT GATTGTATCA TATAGATTTG AAATGTGTTT TTCACGTTGG
ACTCCACATT GTCTTCTATG TTATACCATC TAAAAGTGGC AGCAGCGTGC ATCAATTTGT GCATTAAGAG TAACAGACAA
CAAAAGCCAC CGGTCGTGCG GGTACATCCC TGCCAAGCTT GAGAAACTAA TACTAGAGGA CTACTTTATT AAGTAGCCCT
TTAATTTGCT CCGGTATATC CCTATATCCT GTCCTGAACT ACTACACTTA TGGATTCATG ACCTACAGAT ATTTGAACCG
AGAAGCTTAT CCCATTTGGA GCTTTTTAAC ATTGGATTTG CACGTTTAAC CCTGCTAGCC TTTGTTGAAT ACTTAAAACT
TTGTGGCGAT GACTATATAT ATTGCTTTGA TCACTTAAGC ATAAGTGCCG ATCATTCCAT GTCATTCCAT GTTACTGCTG
ATATTTAAGT GTTTTGATGC CAGAAGTAAT GGTTAGATTG CATTAAAACT TGTTATTAGA TGGGAACAAT TTTAGTAGGC
ACTAATGTTT TCTTCTAGGG CCTCTATAGC TCCCATATAT GGTTGATTGG TCAATCTCAT TGTTCCAAAA TGTCAACCAT
TTGCCCCATG ATGTAGACAG GAGGGGACTT AATTGGGTGT GATATTAACA TTTTGTGATA GTTAGTCTTT GACTGACAAT
AGCTTTCTTT TGCCTGTTCG ATAACTGGAG CCCTTGTCCT GTAGAGCCTC ATGAGCTGTT TATCCTTTGA TGGATACATC
ATTCAGGTTG CACGTTCAAT TTTGTCCTAA ATGAAACATG TCTGATCTGC TCACCTTCTG GTTATCCATC ATCAGCTGCC
CTTTCATGCT GGAATTCTTG TACAATAAAT CAATTAGGTT GAATGAATCA TTAGTCTTAC GTGAGACATA CTTGACTTTG
AAATAATATG GTACAGTGTA CAACACAACG TGTTAATGGA AAGAATTTAT TTGCTTGTAA GTCTAGTAGA CCTTAGGAGC
TAAAATTTTA TTTAGAAAAT TGTTCTAATA ATTGAGGCAC ATGCTAATAC TTTTTCCTTG CAACTGAAAA TTTGTGCATG
CACTTTCCAT AACATAAAAC TGGGCCAAAA TTTACAAGGT TACAAACCAT AGTTTCATTC AATTTTTTTA CTCGCTGATA
TGTCAGCAAC CATGACTCTG AGTAGTCTTG GTGCACTGCA TGTTGGTTGG TATGGATCTG AGTGTTAACT GGAGCATGTT
CCATCTGACA AGTTTTTGCT TATAATAAGT TAATAGATAG TACTGTTTTG CGCCATATTG TTCCAATTTT AGAAGTTATT
TAAACCTTGA TTTCCTCTCT TTTATCAACT CTAGTTGTTG CTAACTTGTT GTAACACCTG TTTAGATGGC AAGCTGACTT
CAATTGTGGT GTGCATGCAT CAACCTTCTT TTTTTTGTGG GTTGGGTTGA CCATGGAATG TTGCATCCTG AGCTAGACAA
GCCATTTGCA TGTAGTCCTT CTCTGTTAGT TGCCAATAAA ATGTCTTGCA GCTGTGGCAA AGGTACTTTT GCATTGCTTG
GTAGAGTGCT TGTCAATTGT TGGATCCTAA CACCTTGTTA ATGTGGATCT GAGGCCTGCG AATATCATGC ATCCCAACCC
CAAAAAATTG TAGAGAAAAT TATGTTACTC TTTATCTAGT GCACAATTGG AGCATCTCTT GTCATCTGTA GTTGATTCCT
TCTATGTTCA TCAGAAACTT GGTGTATTGC CTGTCTTAAT GGCTCTTCCT AGTAAAAGCC TCTAAGATCC TGTCCTTGCG
ATATTATATT CGGTGATGCA CTTGCAGCAC ATATACTCAG ATCTTGCATG TGCATATGTT TTAAAATTCA CATATGTAAA
GCATCATCGA ACATTTCTTG AGTGGCCATA AATTCTACCA TGCCATAGCA GTCACTGTCA AACACACAAT GCTATGCATT
CATGTCCATG GACAATTCAG CTATTTCATG CATCAGCATA TGTCTGTTTT CATTCTAGAA TCACTTTGCC ATCTCATCTT
CTGGTTCGTG GCCTTGATTT TAGTTGTGTT AGTTTTATTT ATTTTGTTAT CCGTAGCCTC ATTGGTTAGC TGATTATGCT
AGAAAAAAAA CTATATCAAC ATGATACCAT ATTGGTGATT CAACACTTAA CTGATGTGAC ATAGACCAAC TTTCAATGCC
CCCTACCATA TATGTATTTG GTCTACCATT AATAGTAAGC ACGACAGTAG TCAAAGGACC AAACTTATCA GTAAGGGAGA
TCACACATGT TCCTATAACA AAGCGGAATC TAATATGCAT GCATATAGTA TTATCCAATT ATTACTATCA TGTTGTCTTG
CAATTTCATT TAGTCATCAA TACACATTGT TTACCTCATG AACTATGTCC GTATTTGTGA TTAGGTTTAA ACAATTCTGG
CTCACATTTA TTAATTATAA AATTGCATGC CTGCATGTTT CATGTTAATT AATGATAAGG CATAGTACAT GCTTGCGCTA
GTTTTTGTAT CACTTGTACT CTTGTTTGAA AATTTTTTTT TGGCTGATGG CAGATTCTAT GGCACATTTT TTATGGTAGA
ATCAGAAATC GGGAATTTGA TGGAGGATGT TGTCATTTGT ATGCATTATT ACATGACAAA AGTTTGTATA GAAGCACAAA
TTTGAGTTTA TATGTTTATG GTTGCAGTCA ACAATTTTGG TGGCAATGCT TATGTCTTGC ATCCTAAGTC TTGGAAATTC
AATTAGAAAT CCAGTACCCA GTATAGTATG GAACTGAGTT TCAGTTCAAC AATATAACTT GCAGATTTTT GAAGAGTTGT
GTCAGTACAT AGTTAATTTC TGACATCCAG AATGTTTATG CCTATTGGTG TAAGCAACTT CTATCTGTGT CATTCATGTA
CTATCTATCT CAATACTTGT AATGTTGCTA TAATGGTATA TGCAGTTGAA AATATGAATT ATATTTATCT TAGTAAGTGA
AACATTTCAA GACACTGATT CTCCTTGGTT TTGTTATTTT GTTCCAGGTG ACCTACTTCA AGTGCGGAGG TGTCTCCCTT
GGAGTTGGTA TGCAACACCA TGTGGCGGAT GGCATGTCCG GTTTGCACTT TATTAACTCA TGGTCTGACC TCTGCCGAGG
AACTCAAATT GCCATCATGC CCTTCATTGA CCGCACTCTC CTACGAGCCC GAGATCCACC AACTCCATCA TACCCACATG
TTGAGTACCA GCCTGCCCCA GCCATGCTGT CCTCCGTACC CCAGTCTGTT ACTGCTAATA AGACAACACC ACCTCCAACT
GCTGTGGACA TTTTCAAGCT TACCCGCTCA GACCTTGGTC GACTGCGTTC GCAGCTCCCA TCAGGAGAAG GTGCACCACG
TTTCAGCACA TATGCAGTTC TTGCTGCACA TGTCTGGCGA TGCGTATCTC TTGCACGTGG CCTGCCTTCT GAACAGCCCA
CTAAGCTGTA TTGTGCCACT GATGGGCGAC AACGGTTGCA GCCTCCACTT CCAGAAGGTT ACTTTGGGAA TGTCATTTTC
ACCGCCACTC CACTTGCTGA GGCAGGCAAG GTGACCAGTG GGCTGGCAGA TGGAGCAGCA GTcatccaag aggcgctaga
taggatgaac gatagctact gccgctcagc attggactac ctggagctgc agcctgattt atcagcattg gtccgtggag
cacacacttt ccggtgtccg aacctcgggc tcaccagctg ggtgcgcttg ccaattcatg atgcagattt tggatgggga
agaccagtgt tcatgGGTCC TGGTGGCATC GCCTATGAAG GGCTGGCGTT TGTCCTCCCA AGCGCGAACA AGGATGGTAG
CCTATCCATA GCCATCTCAT TGCAGGCTGA GCACATGGAG AAGTTCAGGA AGCTGATCTT CGAGGTGTAA GCAGACTACT
TATGTTATGT CAGGGAGAAG TTGTAGAGCT AGAGTTCTCA GGTAAAATAC CTTCAAGTGA GTCATGGGGG CTATGCTCTT
GCTCCTGTTG AGCAAATTGT CTGGCCACGT TCTCTTGTAC CTTAGCTTGC AAGGATATTT GGCCATCACC ACAGCCGTGT
GACGATGTGA GCAACCAATA ATGAGCTGTT TTTTTGTTTT CGTTTAGGAT AGGAATCAAC AATGAAGAAA AGGTGCTGTA
TTCTGTGAAA CTACATGGCA GTGTTGTTCT TACC

Locus: Os04g0500700

Loading...

Locus: Os04g0500700

Loading...