Os04t0500700-02

Locus

Os04g0500700

Description

Similar to Hydroxyanthranilate hydroxycinnamoyltransferase 3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HCT1

CGSNL Gene Name

HYDROXYCINNAMOYLTRANSFERASE 1

Oryzabase Gene Symbol Synonym(s)

OsHCT1

Oryzabase Gene Name Synonym(s)

Hydroxycinnamoyltransferase 1, hydroxycinnamoyl CoA:shikimate/quinate hydroxycinnamoyl transferase 1

Transcript Evidence

AK072528 (DDBJ, Best hit)

AK104637 (DDBJ, Best hit)

Protein Evidence

B6UCS8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

Functional domain (InterPro)

Transferase (IPR003480)

Chloramphenicol acetyltransferase-like domain (IPR023213)

Full-length cDNA

J023131B01 (Online Clone Ordering)

006-310-D12 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0500700-02)

Others

Oryzabase (10356)

Transcript

1880 bp

>Os04t0500700-02 Similar to Hydroxyanthranilate hydroxycinnamoyltransferase 3.
AGCTGCTCTCCACCAAGAGCTGCTCCGCCCCCCTACCCCGCAACCCGTTGCTTTGTGCCG
CGCCTCGCTTTGGTCTTCATCCGCCTCAGATCTGATTCGTTCTAGGTTGGTCTGGGGAAG
ATGGCGATCACGGTGAGGCGGTCGACGATGGTGCGGCCGGCGTGGGAGACGCCGCGGGTG
CGGCTGTGGAACTCGAACCTCGACCTCGTGGTGCCGCGGTTCCACACCCCAAGCGTCTAC
TTCTACCGCCGGGGCCCCGAGGGAGGGGGCGCGCCGGAGGGGTTCTTCGACGGGGAGCGG
ATGCGGCGCGCGCTGGCGGAGGCGCTCGTGCCGTTCTACCCGATGGCCGGGCGGCTCGCG
CGCGACGAGGACGGGAGGGTCGAGATCGACTGCAACGGGGAAGGGGTGCTCTTCGTCGAG
GCCGACGCGCCCGACGCCTCCGTCGATGACTACGGCGACTTCGCGCCCACCATGGAGCTC
AAGCGCCTCATCCCTGCCGTTGATTACACCGACGACATCTCCTCCTTCTCGCTCCTCGTG
CTCCAGGTGACCTACTTCAAGTGCGGAGGTGTCTCCCTTGGAGTTGGTATGCAACACCAT
GTGGCGGATGGCATGTCCGGTTTGCACTTTATTAACTCATGGTCTGACCTCTGCCGAGGA
ACTCAAATTGCCATCATGCCCTTCATTGACCGCACTCTCCTACGAGCCCGAGATCCACCA
ACTCCATCATACCCACATGTTGAGTACCAGCCTGCCCCAGCCATGCTGTCCTCCGTACCC
CAGTCTGTTACTGCTAATAAGACAACACCACCTCCAACTGCTGTGGACATTTTCAAGCTT
ACCCGCTCAGACCTTGGTCGACTGCGTTCGCAGCTCCCATCAGGAGAAGGTGCACCACGT
TTCAGCACATATGCAGTTCTTGCTGCACATGTCTGGCGATGCGTATCTCTTGCACGTGGC
CTGCCTTCTGAACAGCCCACTAAGCTGTATTGTGCCACTGATGGGCGACAACGGTTGCAG
CCTCCACTTCCAGAAGGTTACTTTGGGAATGTCATTTTCACCGCCACTCCACTTGCTGAG
GCAGGCAAGGTGACCAGTGGGCTGGCAGATGGAGCAGCAGTcatccaagaggcgctagat
aggatgaacgatagctactgccgctcagcattggactacctggagctgcagcctgattta
tcagcattggtccgtggagcacacactttccggtgtccgaacctcgggctcaccagctgg
gtgcgcttgccaattcatgatgcagattttggatggggaagaccagtgttcatgGGTCCT
GGTGGCATCGCCTATGAAGGGCTGGCGTTTGTCCTCCCAAGCGCGAACAAGGATGGTAGC
CTATCCATAGCCATCTCATTGCAGGCTGAGCACATGGAGAAGTTCAGGAAGCTGATCTTC
GAGGTGTAAGCAGACTACTTATGTTATGTCAGGGAGAAGTTGTAGAGCTAGAGTTCTCAG
GTAAAATACCTTCAAGTGAGTCATGGGGGCTATGCTCTTGCTCCTGTTGAGCAAATTGTC
TGGCCACGTTCTCTTGTACCTTAGCTTGCAAGGATATTTGGCCATCACCACAGCCGTGTG
ACGATGTGAGCAACCAATAATGAGCTGTTTTTTTGTTTTCGTTTAGGATAGGAATCAACA
ATGAAGAAAAGGTGCTGTATTCTGTGAAACTACATGGCAGTGTTGTTCTTACCAAAAATA
CATGACAAGTGAATTGGGTCAAGTTATTGCCTGTTGTAGCTCAAGTCGATAGATGAACAT
CATTGTACAGTACGAATGTACGATACGACTATAACAGCCTGATTGCCTATGAACTGCAAG
TAAATGCATGTGAATAACTG

CDS

1329 bp

>Os04t0500700-02 Similar to Hydroxyanthranilate hydroxycinnamoyltransferase 3.
ATGGCGATCACGGTGAGGCGGTCGACGATGGTGCGGCCGGCGTGGGAGACGCCGCGGGTG
CGGCTGTGGAACTCGAACCTCGACCTCGTGGTGCCGCGGTTCCACACCCCAAGCGTCTAC
TTCTACCGCCGGGGCCCCGAGGGAGGGGGCGCGCCGGAGGGGTTCTTCGACGGGGAGCGG
ATGCGGCGCGCGCTGGCGGAGGCGCTCGTGCCGTTCTACCCGATGGCCGGGCGGCTCGCG
CGCGACGAGGACGGGAGGGTCGAGATCGACTGCAACGGGGAAGGGGTGCTCTTCGTCGAG
GCCGACGCGCCCGACGCCTCCGTCGATGACTACGGCGACTTCGCGCCCACCATGGAGCTC
AAGCGCCTCATCCCTGCCGTTGATTACACCGACGACATCTCCTCCTTCTCGCTCCTCGTG
CTCCAGGTGACCTACTTCAAGTGCGGAGGTGTCTCCCTTGGAGTTGGTATGCAACACCAT
GTGGCGGATGGCATGTCCGGTTTGCACTTTATTAACTCATGGTCTGACCTCTGCCGAGGA
ACTCAAATTGCCATCATGCCCTTCATTGACCGCACTCTCCTACGAGCCCGAGATCCACCA
ACTCCATCATACCCACATGTTGAGTACCAGCCTGCCCCAGCCATGCTGTCCTCCGTACCC
CAGTCTGTTACTGCTAATAAGACAACACCACCTCCAACTGCTGTGGACATTTTCAAGCTT
ACCCGCTCAGACCTTGGTCGACTGCGTTCGCAGCTCCCATCAGGAGAAGGTGCACCACGT
TTCAGCACATATGCAGTTCTTGCTGCACATGTCTGGCGATGCGTATCTCTTGCACGTGGC
CTGCCTTCTGAACAGCCCACTAAGCTGTATTGTGCCACTGATGGGCGACAACGGTTGCAG
CCTCCACTTCCAGAAGGTTACTTTGGGAATGTCATTTTCACCGCCACTCCACTTGCTGAG
GCAGGCAAGGTGACCAGTGGGCTGGCAGATGGAGCAGCAGTcatccaagaggcgctagat
aggatgaacgatagctactgccgctcagcattggactacctggagctgcagcctgattta
tcagcattggtccgtggagcacacactttccggtgtccgaacctcgggctcaccagctgg
gtgcgcttgccaattcatgatgcagattttggatggggaagaccagtgttcatgGGTCCT
GGTGGCATCGCCTATGAAGGGCTGGCGTTTGTCCTCCCAAGCGCGAACAAGGATGGTAGC
CTATCCATAGCCATCTCATTGCAGGCTGAGCACATGGAGAAGTTCAGGAAGCTGATCTTC
GAGGTGTAA

Protein

443 aa

>Os04t0500700-02 Similar to Hydroxyanthranilate hydroxycinnamoyltransferase 3.
MAITVRRSTMVRPAWETPRVRLWNSNLDLVVPRFHTPSVYFYRRGPEGGGAPEGFFDGER
MRRALAEALVPFYPMAGRLARDEDGRVEIDCNGEGVLFVEADAPDASVDDYGDFAPTMEL
KRLIPAVDYTDDISSFSLLVLQVTYFKCGGVSLGVGMQHHVADGMSGLHFINSWSDLCRG
TQIAIMPFIDRTLLRARDPPTPSYPHVEYQPAPAMLSSVPQSVTANKTTPPPTAVDIFKL
TRSDLGRLRSQLPSGEGAPRFSTYAVLAAHVWRCVSLARGLPSEQPTKLYCATDGRQRLQ
PPLPEGYFGNVIFTATPLAEAGKVTSGLADGAAVIQEALDRMNDSYCRSALDYLELQPDL
SALVRGAHTFRCPNLGLTSWVRLPIHDADFGWGRPVFMGPGGIAYEGLAFVLPSANKDGS
LSIAISLQAEHMEKFRKLIFEV*

5'UTR

chr04:24994004..24994117 (+ strand) : 114 bp

chr04:24994235..24994240 (+ strand) : 6 bp

CDS

chr04:24994241..24994666 (+ strand) : 426 bp

chr04:24998197..24999099 (+ strand) : 903 bp

3'UTR

chr04:24999100..24999530 (+ strand) : 431 bp

FASTA

>Os04t0500700-02 class=Sequence position=chr04:24994004..24999530 (+ strand)
AGCTGCTCTC CACCAAGAGC TGCTCCGCCC CCCTACCCCG CAACCCGTTG CTTTGTGCCG CGCCTCGCTT TGGTCTTCAT
CCGCCTCAGA TCTGATTCGT TCTAGGTTGG TCTGGTGAGT GGTGCTTGGC GTTTTTGTTT TTTGTTTTTT TTTTGTTTTC
GTGTGTGAGG GGATTGGGAT GCTCACGAGG TGTTTGGTGG TATGCGTGGG CGGCGGCGGC GGCGGTGGCA GGGGAAGATG
GCGATCACGG TGAGGCGGTC GACGATGGTG CGGCCGGCGT GGGAGACGCC GCGGGTGCGG CTGTGGAACT CGAACCTCGA
CCTCGTGGTG CCGCGGTTCC ACACCCCAAG CGTCTACTTC TACCGCCGGG GCCCCGAGGG AGGGGGCGCG CCGGAGGGGT
TCTTCGACGG GGAGCGGATG CGGCGCGCGC TGGCGGAGGC GCTCGTGCCG TTCTACCCGA TGGCCGGGCG GCTCGCGCGC
GACGAGGACG GGAGGGTCGA GATCGACTGC AACGGGGAAG GGGTGCTCTT CGTCGAGGCC GACGCGCCCG ACGCCTCCGT
CGATGACTAC GGCGACTTCG CGCCCACCAT GGAGCTCAAG CGCCTCATCC CTGCCGTTGA TTACACCGAC GACATCTCCT
CCTTCTCGCT CCTCGTGCTC CAGGTGAGCT CCAAATTTCT AGTAGCAAGT ACAGTTAGAT CCAAGCACAA AATCAAACGA
GGTTAGAGAT AGCTTTCTGG AAGTGGAGCG CAAACAATGC TTTGCAACTG CAGCTGACAA CTAAGTTTGG CAGTAAGCCA
TTAATTATAA CATTTTGGGG CTGATTGTAT AGCTAGGTCC CATGTTGGCT GTTGCACTAA ATGTTTGGGG CTGAGCTTAG
CGGGTCACCT ACTCTTTGGT TGGCTTTAAT TAGCTGCATC AGATGTACGG TTCCATCCAG GCAGTTGATG TCTTTCTGTT
GTGGGCGGGG TCTATTTTTG GTTTGATGTT TATGCTTATT GTGATAGTTT AGTAGGGGTT GTGTAGGAAT TATAGAATTT
TAAAACACCA TAATTCAATG CCAATAATCA GTATCCACTA AAAAAATGAA GTATATGCTT CACCTTGACT GTGTCAAAGC
CTAGACAATT TTGATTTGTC CAGAGTGATT GTATCATATA GATTTGAAAT GTGTTTTTCA CGTTGGACTC CACATTGTCT
TCTATGTTAT ACCATCTAAA AGTGGCAGCA GCGTGCATCA ATTTGTGCAT TAAGAGTAAC AGACAACAAA AGCCACCGGT
CGTGCGGGTA CATCCCTGCC AAGCTTGAGA AACTAATACT AGAGGACTAC TTTATTAAGT AGCCCTTTAA TTTGCTCCGG
TATATCCCTA TATCCTGTCC TGAACTACTA CACTTATGGA TTCATGACCT ACAGATATTT GAACCGAGAA GCTTATCCCA
TTTGGAGCTT TTTAACATTG GATTTGCACG TTTAACCCTG CTAGCCTTTG TTGAATACTT AAAACTTTGT GGCGATGACT
ATATATATTG CTTTGATCAC TTAAGCATAA GTGCCGATCA TTCCATGTCA TTCCATGTTA CTGCTGATAT TTAAGTGTTT
TGATGCCAGA AGTAATGGTT AGATTGCATT AAAACTTGTT ATTAGATGGG AACAATTTTA GTAGGCACTA ATGTTTTCTT
CTAGGGCCTC TATAGCTCCC ATATATGGTT GATTGGTCAA TCTCATTGTT CCAAAATGTC AACCATTTGC CCCATGATGT
AGACAGGAGG GGACTTAATT GGGTGTGATA TTAACATTTT GTGATAGTTA GTCTTTGACT GACAATAGCT TTCTTTTGCC
TGTTCGATAA CTGGAGCCCT TGTCCTGTAG AGCCTCATGA GCTGTTTATC CTTTGATGGA TACATCATTC AGGTTGCACG
TTCAATTTTG TCCTAAATGA AACATGTCTG ATCTGCTCAC CTTCTGGTTA TCCATCATCA GCTGCCCTTT CATGCTGGAA
TTCTTGTACA ATAAATCAAT TAGGTTGAAT GAATCATTAG TCTTACGTGA GACATACTTG ACTTTGAAAT AATATGGTAC
AGTGTACAAC ACAACGTGTT AATGGAAAGA ATTTATTTGC TTGTAAGTCT AGTAGACCTT AGGAGCTAAA ATTTTATTTA
GAAAATTGTT CTAATAATTG AGGCACATGC TAATACTTTT TCCTTGCAAC TGAAAATTTG TGCATGCACT TTCCATAACA
TAAAACTGGG CCAAAATTTA CAAGGTTACA AACCATAGTT TCATTCAATT TTTTTACTCG CTGATATGTC AGCAACCATG
ACTCTGAGTA GTCTTGGTGC ACTGCATGTT GGTTGGTATG GATCTGAGTG TTAACTGGAG CATGTTCCAT CTGACAAGTT
TTTGCTTATA ATAAGTTAAT AGATAGTACT GTTTTGCGCC ATATTGTTCC AATTTTAGAA GTTATTTAAA CCTTGATTTC
CTCTCTTTTA TCAACTCTAG TTGTTGCTAA CTTGTTGTAA CACCTGTTTA GATGGCAAGC TGACTTCAAT TGTGGTGTGC
ATGCATCAAC CTTCTTTTTT TTGTGGGTTG GGTTGACCAT GGAATGTTGC ATCCTGAGCT AGACAAGCCA TTTGCATGTA
GTCCTTCTCT GTTAGTTGCC AATAAAATGT CTTGCAGCTG TGGCAAAGGT ACTTTTGCAT TGCTTGGTAG AGTGCTTGTC
AATTGTTGGA TCCTAACACC TTGTTAATGT GGATCTGAGG CCTGCGAATA TCATGCATCC CAACCCCAAA AAATTGTAGA
GAAAATTATG TTACTCTTTA TCTAGTGCAC AATTGGAGCA TCTCTTGTCA TCTGTAGTTG ATTCCTTCTA TGTTCATCAG
AAACTTGGTG TATTGCCTGT CTTAATGGCT CTTCCTAGTA AAAGCCTCTA AGATCCTGTC CTTGCGATAT TATATTCGGT
GATGCACTTG CAGCACATAT ACTCAGATCT TGCATGTGCA TATGTTTTAA AATTCACATA TGTAAAGCAT CATCGAACAT
TTCTTGAGTG GCCATAAATT CTACCATGCC ATAGCAGTCA CTGTCAAACA CACAATGCTA TGCATTCATG TCCATGGACA
ATTCAGCTAT TTCATGCATC AGCATATGTC TGTTTTCATT CTAGAATCAC TTTGCCATCT CATCTTCTGG TTCGTGGCCT
TGATTTTAGT TGTGTTAGTT TTATTTATTT TGTTATCCGT AGCCTCATTG GTTAGCTGAT TATGCTAGAA AAAAAACTAT
ATCAACATGA TACCATATTG GTGATTCAAC ACTTAACTGA TGTGACATAG ACCAACTTTC AATGCCCCCT ACCATATATG
TATTTGGTCT ACCATTAATA GTAAGCACGA CAGTAGTCAA AGGACCAAAC TTATCAGTAA GGGAGATCAC ACATGTTCCT
ATAACAAAGC GGAATCTAAT ATGCATGCAT ATAGTATTAT CCAATTATTA CTATCATGTT GTCTTGCAAT TTCATTTAGT
CATCAATACA CATTGTTTAC CTCATGAACT ATGTCCGTAT TTGTGATTAG GTTTAAACAA TTCTGGCTCA CATTTATTAA
TTATAAAATT GCATGCCTGC ATGTTTCATG TTAATTAATG ATAAGGCATA GTACATGCTT GCGCTAGTTT TTGTATCACT
TGTACTCTTG TTTGAAAATT TTTTTTTGGC TGATGGCAGA TTCTATGGCA CATTTTTTAT GGTAGAATCA GAAATCGGGA
ATTTGATGGA GGATGTTGTC ATTTGTATGC ATTATTACAT GACAAAAGTT TGTATAGAAG CACAAATTTG AGTTTATATG
TTTATGGTTG CAGTCAACAA TTTTGGTGGC AATGCTTATG TCTTGCATCC TAAGTCTTGG AAATTCAATT AGAAATCCAG
TACCCAGTAT AGTATGGAAC TGAGTTTCAG TTCAACAATA TAACTTGCAG ATTTTTGAAG AGTTGTGTCA GTACATAGTT
AATTTCTGAC ATCCAGAATG TTTATGCCTA TTGGTGTAAG CAACTTCTAT CTGTGTCATT CATGTACTAT CTATCTCAAT
ACTTGTAATG TTGCTATAAT GGTATATGCA GTTGAAAATA TGAATTATAT TTATCTTAGT AAGTGAAACA TTTCAAGACA
CTGATTCTCC TTGGTTTTGT TATTTTGTTC CAGGTGACCT ACTTCAAGTG CGGAGGTGTC TCCCTTGGAG TTGGTATGCA
ACACCATGTG GCGGATGGCA TGTCCGGTTT GCACTTTATT AACTCATGGT CTGACCTCTG CCGAGGAACT CAAATTGCCA
TCATGCCCTT CATTGACCGC ACTCTCCTAC GAGCCCGAGA TCCACCAACT CCATCATACC CACATGTTGA GTACCAGCCT
GCCCCAGCCA TGCTGTCCTC CGTACCCCAG TCTGTTACTG CTAATAAGAC AACACCACCT CCAACTGCTG TGGACATTTT
CAAGCTTACC CGCTCAGACC TTGGTCGACT GCGTTCGCAG CTCCCATCAG GAGAAGGTGC ACCACGTTTC AGCACATATG
CAGTTCTTGC TGCACATGTC TGGCGATGCG TATCTCTTGC ACGTGGCCTG CCTTCTGAAC AGCCCACTAA GCTGTATTGT
GCCACTGATG GGCGACAACG GTTGCAGCCT CCACTTCCAG AAGGTTACTT TGGGAATGTC ATTTTCACCG CCACTCCACT
TGCTGAGGCA GGCAAGGTGA CCAGTGGGCT GGCAGATGGA GCAGCAGTca tccaagaggc gctagatagg atgaacgata
gctactgccg ctcagcattg gactacctgg agctgcagcc tgatttatca gcattggtcc gtggagcaca cactttccgg
tgtccgaacc tcgggctcac cagctgggtg cgcttgccaa ttcatgatgc agattttgga tggggaagac cagtgttcat
gGGTCCTGGT GGCATCGCCT ATGAAGGGCT GGCGTTTGTC CTCCCAAGCG CGAACAAGGA TGGTAGCCTA TCCATAGCCA
TCTCATTGCA GGCTGAGCAC ATGGAGAAGT TCAGGAAGCT GATCTTCGAG GTGTAAGCAG ACTACTTATG TTATGTCAGG
GAGAAGTTGT AGAGCTAGAG TTCTCAGGTA AAATACCTTC AAGTGAGTCA TGGGGGCTAT GCTCTTGCTC CTGTTGAGCA
AATTGTCTGG CCACGTTCTC TTGTACCTTA GCTTGCAAGG ATATTTGGCC ATCACCACAG CCGTGTGACG ATGTGAGCAA
CCAATAATGA GCTGTTTTTT TGTTTTCGTT TAGGATAGGA ATCAACAATG AAGAAAAGGT GCTGTATTCT GTGAAACTAC
ATGGCAGTGT TGTTCTTACC AAAAATACAT GACAAGTGAA TTGGGTCAAG TTATTGCCTG TTGTAGCTCA AGTCGATAGA
TGAACATCAT TGTACAGTAC GAATGTACGA TACGACTATA ACAGCCTGAT TGCCTATGAA CTGCAAGTAA ATGCATGTGA
ATAACTG

Locus: Os04g0500700

Loading...

Locus: Os04g0500700

Loading...