Os04t0508000-01

Locus

Os04g0508000

Description

Protein of unknown function DUF231, plant domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsTBL30, TBL30

Oryzabase Gene Name Synonym(s)

trichome birefringence-like 30

Transcript Evidence

AK071432 (DDBJ, Best hit)

Protein Evidence

Q01I78 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Domain of unknown function DUF231, plant (IPR004253)

Full-length cDNA

J023092D01 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0508000-01)

RiceXPro (AK071432)

Others

Oryzabase (21485)

KEGG (Os04t0508000-01)

Transcript

2487 bp

>Os04t0508000-01 Protein of unknown function DUF231, plant domain containing protein.
GCTCGCTTCACTCCCCAGCAAGTTGCGGCGGCGGCGCGCGGCTAGCCGGACACACCGATC
ACGCTGACTAGCTAGTACTAGTAGCTATTGAATGGCCGGCGCGTGGAGGAAGGCGTGGCT
GTCGATGCTGGACCGAGGCGGCGGATCAGGCGCGGGCGGCGGAGGCGGCGGGAGCAGCGG
GTCGCTGCACGTGCACCTCCACGGCCTCCTCTCCCCGTCCTCGTCGTCGTCGTCGCTCAA
CGGTTACAAGCGCGGCGGCGGTAAGCACGGCGGCGGTGGTGGTTGCGGCGGCGGCCATGT
GATGACGAGTAGCAAGGCCGTGCTGGCATGCTTCTCCGTCGCGCTCGTGGTGGCCTTCTT
CTACGTCTCCGTCGCCAGCGGCCCCACCGCGGACGCCGCCTCGTTCCCTTCCCCGACGGG
GGCGTCGTCGTCGTCACTCCTGTCGTGGCTGTCGTCGAACTCGACGTCGGCGGCGGCGCT
GCCGAGGAGGTCTCTCCCGCCTCACCCGCCCATTCCTCCTGCCGGCGGCGGCGCTGATCT
GCGTAACACCGCGCGTAGAACGCAGAGCGGCGCCGAGGGCTCGGGGTTGCCGGCGCCGGC
GGCGGAGCAAACGGCCAAACCGCGGGTTTCTGATCTCCGGTCGGGCGCCGGGAACGCCAC
CGTCGGTGACGTCGACGGGGATCAACGCGTCGGGAATGGCACGCGATCACGACAGCAGCG
AGAGGAAACCGCAACACCAATGCCGCGATGGCAGAGAAGGGACGAGGAGAAGAACTCCAC
CCACCACGCCATCGTCGCCGCTCCCGGCAACTCCACCGACGCCCCGGCCCCACCACTGAA
CTCGACGGCGACGCCGCGAGCCGCAGCAGCAGCCGCAGCCACGCCATCGACGCCGCCGGA
GAGGAAGGCTGACACCCACCACAGCCATCGGAGAGGCATCAGGCACAAGCAGCAGCAGCA
TCACCAGCACCCGAGGCGGCGAAAGGACACCGTCCTCCTCGCGGCGGCGGCGGCGCGCCA
AGAAGCTCCCGATCGCCGCGACGACGGCGCCGCCATGCCATTGCCCGCCGCGACGATCAT
CAACACCAGCACCGTCGGCGACAACCGCGTCGTCTGGACGTCCGGCGTGCAGAGTGGCCT
GGTCTCCTTCGCCAAGTGCGACGTGTTCAGTGGCCGCTGGGTGCGCGATGACGACGAGGG
CGGCGGCGCCTACCCGTTCTACCCGCCGGGCTCGTGCCCCCACATCGACGACGACTTCAA
CTGCCACAAGAACGGCCGCGCCGACACCGGCTTCCTCAGGTGGAGGTGGCAGCCGCACGG
CTGCGACATCCCCAGGCTGAACCCGATTGATTTTCTGGAGAGGCTGAGAGGGCAGAGGAT
CATATTCGTCGGCGACTCACTGAACCGCAACATGTGGGAGTCTCTGGTGTGCATTCTGCG
GCATGGTGTCAGGGACAAGAGGAGGATGTATGAAGCGTCAGGGAGGAACCAGTTCAAGAC
CAGGGGATACTACTCCTTCAGATTCAGGGATTACAATTGCTCCGTGGATTTCATAAGATC
AATATTTCTAGTCAAGGAGATGATCAACGAGACCAAAGGCGGCGCCGTGGTGGACGCTAA
GTTGAGATTGGATGAACTCGATGAAACGACTCCGGCGTACCGGACTGCCGACATCGTCGT
CTTCAACACCGGCCACTGGTGGACGCACTGGAAAACATCAAGAGGGCTGAATTACTACCA
AGAAGGTAACTACGTGCACCCCAGCCTCGAGGTGATGGACGCATACAAGAGAGCTCTGAC
CACCTGGGCTAGATGGGTCGACAAGAACATCGACTCCACAAGAACTCAGGTGGTGTTCAG
AGGATACTCCCTCACACATTTCAGGGGAGGGCAGTGGAACTCAGGAGGGAGATGCCACAG
GGAGACGGAGCCGATCTTCAACCGGACGCACCTCGCCGAGTACCCGGAGAAGATGAGGAT
CCTGGAGCAGGTGCTGGGGCGGATGAGGACGCCGGTGATCTACCTCAACATCAGCGCCAT
GACGGACTACCGCAAGGACGCCCACCCGTCGGTGTACCGGGTGCGGTACGAGACGGAGGA
GGAGCGGATGGCGGCGGTGGCGAAGCAGGACTGCAGCCACTGGTGCCTGCCCGGCGTGCC
GGATTCCTGGAACGAGCTGCTGTACGCCTCGCTGCTCCAGGCAGGGAGAGGATCGTGGAG
ACTATGAGAAGTTGATTTCTCAAAATCTCTTGACAGTTGACACACAAGGCACAGGCGAAA
AAAAAAAGATGAGTGGTAACATGGTTCATGTTAGAGGTGCACATAAACACAGGAAAATCC
TGCAGTGAGTAGATCAGGTAGAAGCAGATTAATCGTTAATAAGATGATGAGGTTTTAATT
CTTTCCTCCCGGTAGTTCATGTACATATGAGAGCTTAATAACTGATGTACCATCTGAAGA
ATATCATCACATATTCATATCGAAACC

CDS

2136 bp

>Os04t0508000-01 Protein of unknown function DUF231, plant domain containing protein.
ATGGCCGGCGCGTGGAGGAAGGCGTGGCTGTCGATGCTGGACCGAGGCGGCGGATCAGGC
GCGGGCGGCGGAGGCGGCGGGAGCAGCGGGTCGCTGCACGTGCACCTCCACGGCCTCCTC
TCCCCGTCCTCGTCGTCGTCGTCGCTCAACGGTTACAAGCGCGGCGGCGGTAAGCACGGC
GGCGGTGGTGGTTGCGGCGGCGGCCATGTGATGACGAGTAGCAAGGCCGTGCTGGCATGC
TTCTCCGTCGCGCTCGTGGTGGCCTTCTTCTACGTCTCCGTCGCCAGCGGCCCCACCGCG
GACGCCGCCTCGTTCCCTTCCCCGACGGGGGCGTCGTCGTCGTCACTCCTGTCGTGGCTG
TCGTCGAACTCGACGTCGGCGGCGGCGCTGCCGAGGAGGTCTCTCCCGCCTCACCCGCCC
ATTCCTCCTGCCGGCGGCGGCGCTGATCTGCGTAACACCGCGCGTAGAACGCAGAGCGGC
GCCGAGGGCTCGGGGTTGCCGGCGCCGGCGGCGGAGCAAACGGCCAAACCGCGGGTTTCT
GATCTCCGGTCGGGCGCCGGGAACGCCACCGTCGGTGACGTCGACGGGGATCAACGCGTC
GGGAATGGCACGCGATCACGACAGCAGCGAGAGGAAACCGCAACACCAATGCCGCGATGG
CAGAGAAGGGACGAGGAGAAGAACTCCACCCACCACGCCATCGTCGCCGCTCCCGGCAAC
TCCACCGACGCCCCGGCCCCACCACTGAACTCGACGGCGACGCCGCGAGCCGCAGCAGCA
GCCGCAGCCACGCCATCGACGCCGCCGGAGAGGAAGGCTGACACCCACCACAGCCATCGG
AGAGGCATCAGGCACAAGCAGCAGCAGCATCACCAGCACCCGAGGCGGCGAAAGGACACC
GTCCTCCTCGCGGCGGCGGCGGCGCGCCAAGAAGCTCCCGATCGCCGCGACGACGGCGCC
GCCATGCCATTGCCCGCCGCGACGATCATCAACACCAGCACCGTCGGCGACAACCGCGTC
GTCTGGACGTCCGGCGTGCAGAGTGGCCTGGTCTCCTTCGCCAAGTGCGACGTGTTCAGT
GGCCGCTGGGTGCGCGATGACGACGAGGGCGGCGGCGCCTACCCGTTCTACCCGCCGGGC
TCGTGCCCCCACATCGACGACGACTTCAACTGCCACAAGAACGGCCGCGCCGACACCGGC
TTCCTCAGGTGGAGGTGGCAGCCGCACGGCTGCGACATCCCCAGGCTGAACCCGATTGAT
TTTCTGGAGAGGCTGAGAGGGCAGAGGATCATATTCGTCGGCGACTCACTGAACCGCAAC
ATGTGGGAGTCTCTGGTGTGCATTCTGCGGCATGGTGTCAGGGACAAGAGGAGGATGTAT
GAAGCGTCAGGGAGGAACCAGTTCAAGACCAGGGGATACTACTCCTTCAGATTCAGGGAT
TACAATTGCTCCGTGGATTTCATAAGATCAATATTTCTAGTCAAGGAGATGATCAACGAG
ACCAAAGGCGGCGCCGTGGTGGACGCTAAGTTGAGATTGGATGAACTCGATGAAACGACT
CCGGCGTACCGGACTGCCGACATCGTCGTCTTCAACACCGGCCACTGGTGGACGCACTGG
AAAACATCAAGAGGGCTGAATTACTACCAAGAAGGTAACTACGTGCACCCCAGCCTCGAG
GTGATGGACGCATACAAGAGAGCTCTGACCACCTGGGCTAGATGGGTCGACAAGAACATC
GACTCCACAAGAACTCAGGTGGTGTTCAGAGGATACTCCCTCACACATTTCAGGGGAGGG
CAGTGGAACTCAGGAGGGAGATGCCACAGGGAGACGGAGCCGATCTTCAACCGGACGCAC
CTCGCCGAGTACCCGGAGAAGATGAGGATCCTGGAGCAGGTGCTGGGGCGGATGAGGACG
CCGGTGATCTACCTCAACATCAGCGCCATGACGGACTACCGCAAGGACGCCCACCCGTCG
GTGTACCGGGTGCGGTACGAGACGGAGGAGGAGCGGATGGCGGCGGTGGCGAAGCAGGAC
TGCAGCCACTGGTGCCTGCCCGGCGTGCCGGATTCCTGGAACGAGCTGCTGTACGCCTCG
CTGCTCCAGGCAGGGAGAGGATCGTGGAGACTATGA

Protein

712 aa

>Os04t0508000-01 Protein of unknown function DUF231, plant domain containing protein.
MAGAWRKAWLSMLDRGGGSGAGGGGGGSSGSLHVHLHGLLSPSSSSSSLNGYKRGGGKHG
GGGGCGGGHVMTSSKAVLACFSVALVVAFFYVSVASGPTADAASFPSPTGASSSSLLSWL
SSNSTSAAALPRRSLPPHPPIPPAGGGADLRNTARRTQSGAEGSGLPAPAAEQTAKPRVS
DLRSGAGNATVGDVDGDQRVGNGTRSRQQREETATPMPRWQRRDEEKNSTHHAIVAAPGN
STDAPAPPLNSTATPRAAAAAAATPSTPPERKADTHHSHRRGIRHKQQQHHQHPRRRKDT
VLLAAAAARQEAPDRRDDGAAMPLPAATIINTSTVGDNRVVWTSGVQSGLVSFAKCDVFS
GRWVRDDDEGGGAYPFYPPGSCPHIDDDFNCHKNGRADTGFLRWRWQPHGCDIPRLNPID
FLERLRGQRIIFVGDSLNRNMWESLVCILRHGVRDKRRMYEASGRNQFKTRGYYSFRFRD
YNCSVDFIRSIFLVKEMINETKGGAVVDAKLRLDELDETTPAYRTADIVVFNTGHWWTHW
KTSRGLNYYQEGNYVHPSLEVMDAYKRALTTWARWVDKNIDSTRTQVVFRGYSLTHFRGG
QWNSGGRCHRETEPIFNRTHLAEYPEKMRILEQVLGRMRTPVIYLNISAMTDYRKDAHPS
VYRVRYETEEERMAAVAKQDCSHWCLPGVPDSWNELLYASLLQAGRGSWRL*

5'UTR

chr04:25384856..25384946 (- strand) : 91 bp

CDS

chr04:25383612..25384855 (- strand) : 1244 bp

chr04:25383170..25383362 (- strand) : 193 bp

chr04:25382885..25383081 (- strand) : 197 bp

chr04:25382615..25382773 (- strand) : 159 bp

chr04:25381977..25382319 (- strand) : 343 bp

3'UTR

chr04:25381717..25381976 (- strand) : 260 bp

FASTA

>Os04t0508000-01 class=Sequence position=chr04:25381717..25384946 (- strand)
GCTCGCTTCA CTCCCCAGCA AGTTGCGGCG GCGGCGCGCG GCTAGCCGGA CACACCGATC ACGCTGACTA GCTAGTACTA
GTAGCTATTG AATGGCCGGC GCGTGGAGGA AGGCGTGGCT GTCGATGCTG GACCGAGGCG GCGGATCAGG CGCGGGCGGC
GGAGGCGGCG GGAGCAGCGG GTCGCTGCAC GTGCACCTCC ACGGCCTCCT CTCCCCGTCC TCGTCGTCGT CGTCGCTCAA
CGGTTACAAG CGCGGCGGCG GTAAGCACGG CGGCGGTGGT GGTTGCGGCG GCGGCCATGT GATGACGAGT AGCAAGGCCG
TGCTGGCATG CTTCTCCGTC GCGCTCGTGG TGGCCTTCTT CTACGTCTCC GTCGCCAGCG GCCCCACCGC GGACGCCGCC
TCGTTCCCTT CCCCGACGGG GGCGTCGTCG TCGTCACTCC TGTCGTGGCT GTCGTCGAAC TCGACGTCGG CGGCGGCGCT
GCCGAGGAGG TCTCTCCCGC CTCACCCGCC CATTCCTCCT GCCGGCGGCG GCGCTGATCT GCGTAACACC GCGCGTAGAA
CGCAGAGCGG CGCCGAGGGC TCGGGGTTGC CGGCGCCGGC GGCGGAGCAA ACGGCCAAAC CGCGGGTTTC TGATCTCCGG
TCGGGCGCCG GGAACGCCAC CGTCGGTGAC GTCGACGGGG ATCAACGCGT CGGGAATGGC ACGCGATCAC GACAGCAGCG
AGAGGAAACC GCAACACCAA TGCCGCGATG GCAGAGAAGG GACGAGGAGA AGAACTCCAC CCACCACGCC ATCGTCGCCG
CTCCCGGCAA CTCCACCGAC GCCCCGGCCC CACCACTGAA CTCGACGGCG ACGCCGCGAG CCGCAGCAGC AGCCGCAGCC
ACGCCATCGA CGCCGCCGGA GAGGAAGGCT GACACCCACC ACAGCCATCG GAGAGGCATC AGGCACAAGC AGCAGCAGCA
TCACCAGCAC CCGAGGCGGC GAAAGGACAC CGTCCTCCTC GCGGCGGCGG CGGCGCGCCA AGAAGCTCCC GATCGCCGCG
ACGACGGCGC CGCCATGCCA TTGCCCGCCG CGACGATCAT CAACACCAGC ACCGTCGGCG ACAACCGCGT CGTCTGGACG
TCCGGCGTGC AGAGTGGCCT GGTCTCCTTC GCCAAGTGCG ACGTGTTCAG TGGCCGCTGG GTGCGCGATG ACGACGAGGG
CGGCGGCGCC TACCCGTTCT ACCCGCCGGG CTCGTGCCCC CACATCGACG ACGACTTCAA CTGCCACAAG AACGGCCGCG
CCGACACCGG CTTCCTCAGG TGGAGGTGGC AGCCGCACGG CTGCGACATC CCCAGGTGAG CCCAACAACC TCAGCTCCTG
TGAACTTCCC AGTAACTCCA AGAGAACCGG AGGTCAGTGG GACCCACATG TCAGCGACCA TGTCTTTCTG ACGTTACGTT
GCGTAACGTT AGAGGATCTT GTTCCGTCAC GTACACTGTA ATATGCACGC GACACCTTTC TGAATTCGCT TCGGAATTAT
AAAAATTTCA AGATCATTTC GAGTGCATTT GTGATCGAAG CTTAATTCTC TTCTGCTTCA TCAGGCTGAA CCCGATTGAT
TTTCTGGAGA GGCTGAGAGG GCAGAGGATC ATATTCGTCG GCGACTCACT GAACCGCAAC ATGTGGGAGT CTCTGGTGTG
CATTCTGCGG CATGGTGTCA GGGACAAGAG GAGGATGTAT GAAGCGTCAG GGAGGAACCA GTTCAAGACC AGGGGATACT
ACTCCTTCAG ATTCAGGGTA CACAGCTAGG CTGGCTCACT GAACAACACT AGCTCTGAAT TTTGTCAACA TTTGTATCTC
ATGGCTAATT TCACTGCACT TGTAGGATTA CAATTGCTCC GTGGATTTCA TAAGATCAAT ATTTCTAGTC AAGGAGATGA
TCAACGAGAC CAAAGGCGGC GCCGTGGTGG ACGCTAAGTT GAGATTGGAT GAACTCGATG AAACGACTCC GGCGTACCGG
ACTGCCGACA TCGTCGTCTT CAACACCGGC CACTGGTGGA CGCACTGGAA AACATCAAGA GGGTATATCA CACCGTTCTC
CAAACTGAAC TTCCACATGA AACTTTACAC AAAATCTGTC ATTTCACCCT CTCCTGCCAA ACCATTGATC AAACGTTGTT
CTTGTCTCCA CAGGCTGAAT TACTACCAAG AAGGTAACTA CGTGCACCCC AGCCTCGAGG TGATGGACGC ATACAAGAGA
GCTCTGACCA CCTGGGCTAG ATGGGTCGAC AAGAACATCG ACTCCACAAG AACTCAGGTG GTGTTCAGAG GATACTCCCT
CACACATTTC AGGTAAGAGA TCGAATCACA CATCTCCGTC GCACCATCCG ATCATCACCA GGGTTCAATC TTTCGTTTTC
AGTGTTTGTA TCAGAGGGTG TCGATATACC GAAATTTTAG AAAATTCAGT TGTATCAGAC CCCGATATGA TATTATTTCA
GCCAAAATAT TTAAAGTTTT TCATGTTTTT TTGGTGAATT TGGTAATATT TTGTCCAAAT TTTGTTCCGG AATTTTGAAC
TCTAATCATC ACACGGCGTA TTCTTCTTCT CCTCCATCTC ATCTGATGAT CCATCTTCAC CTTCCAGGGG AGGGCAGTGG
AACTCAGGAG GGAGATGCCA CAGGGAGACG GAGCCGATCT TCAACCGGAC GCACCTCGCC GAGTACCCGG AGAAGATGAG
GATCCTGGAG CAGGTGCTGG GGCGGATGAG GACGCCGGTG ATCTACCTCA ACATCAGCGC CATGACGGAC TACCGCAAGG
ACGCCCACCC GTCGGTGTAC CGGGTGCGGT ACGAGACGGA GGAGGAGCGG ATGGCGGCGG TGGCGAAGCA GGACTGCAGC
CACTGGTGCC TGCCCGGCGT GCCGGATTCC TGGAACGAGC TGCTGTACGC CTCGCTGCTC CAGGCAGGGA GAGGATCGTG
GAGACTATGA GAAGTTGATT TCTCAAAATC TCTTGACAGT TGACACACAA GGCACAGGCG AAAAAAAAAA GATGAGTGGT
AACATGGTTC ATGTTAGAGG TGCACATAAA CACAGGAAAA TCCTGCAGTG AGTAGATCAG GTAGAAGCAG ATTAATCGTT
AATAAGATGA TGAGGTTTTA ATTCTTTCCT CCCGGTAGTT CATGTACATA TGAGAGCTTA ATAACTGATG TACCATCTGA
AGAATATCAT CACATATTCA TATCGAAACC 

Locus: Os04g0508000

Loading...

Locus: Os04g0508000

Loading...