Os04t0512400-01

Locus

Os04g0512400

Description

Similar to Midline 1 protein (Tripartite motif protein 18).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsRFPHC-12

Oryzabase Gene Name Synonym(s)

RING finger protein OsRFPHC-12, RING-HC protein 12

Transcript Evidence

AK103203 (DDBJ, Best hit)

Protein Evidence

Q01HD4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: intracellular (GO:0005622)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

BRCT (IPR001357)

Zinc finger, RING-type (IPR001841)

Zinc finger, PHD-type (IPR001965)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, C3HC4 RING-type (IPR018957)

Full-length cDNA

J033122C24 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0512400-01)

RiceXPro (AK103203)

Others

Oryzabase (11795)

KEGG (Os04t0512400-01)

Transcript

2399 bp

>Os04t0512400-01 Similar to Midline 1 protein (Tripartite motif protein 18).
GGGGGCGCGCGCCTGCGCGCCTCTCTCCCGCAGTCCCGCCCGCCCGCGCGCGCGCGCGGC
GCTCGAAACAGGCAATCGCTTTCCCCATCCAAAACCAGTCCACCCTCGCGCCGCGGGGGA
AAACCCCGAAAAATTTTCTTCTTCCCGCCGATGGCACGCCGGTTCAGACCCGCGCCCGCA
CGCGGCGGCATCCAAACATTTTTTTTCCAGCCGCCGCCACCCCTTCCCTCCAATTTTCGA
GCGTGGCCACGCGTATTTCAGTGGCTCCGGAGCTAGCTTAATTAGCAGTGCCCACAAGCC
ACCGTCTCCGCAGTCCGCACACAGGTTCTTCAATCCTTTGAGAGAGAGCGAGAGCGAGAG
CGAGACCGTGCGGCCGTGCAGGGATGGAGAGCTTCAGGAGGTTCCTGAACCCGCTGGTGC
TCAACCTGCAGAAGATGGAGCTGGAGCTCACCTGCCCCGTCTGCCTGAAGTTGCTCAACG
CGCCTACCATGCTGCCATGTTACCACACTTCCTGCAGCAAGTGTGCTACTACACGGACCA
TGGACGGTTACAGCTGCGCGATTTGCAAATCAGCTTATCGTTCTCAAGACCTAAGGCCTG
CCTCTCACCTCGAGGCAATAGTGAACATCCACAGGAGCCTAAGCTCTACAGTCAGCAGCA
TGGTCACTCAGCAGGAGGCTCAAGCTGATATTCCTGTTGCAAAGACATCATTTCAAGGAA
CTCCAGAATCGGGAAACAGAAATGGAGCAGAGAAATCTGATCAGGTGAAATCATACACCC
CGGTTGCTTCTAAACTGGCATATAACCAGTCAACTGGGCTTGCATATGGAAATGTGGACG
GCGTGAAAGAAAGAAATCCTGCATTGGAGACTAGAGGTGCGGCTGATGTGACTGCTATGC
CCACAATTCTTGTGCAGAAGGGACCCTGCCGATCTCAATCTTCTGATGGCCCTAGGGATC
TGGATTGCGACAGCAATGACCTTGAAGGAGAGCTGATAACAAGCAGATCATCTCCTCAAA
GTGTCTTGAAAAGAGAACCAAATACAGCGAATGATGATAATAGAGAATTAAAAAGGCAAA
AGTCCACTGATCAGGATGATAGACAACCAGCTGTTGCTGGTGCTTGGAAATGTGAATTTT
GTCACTCTTCCAAAACCACTGAGAGTACTGGCCCTCTGTCCCATTATCTGCATGGTGAGC
CATTAGAGGATAACCAAGCATGGAAACCAAACGTTTTACATGTTCATGAGAAGTGCATTG
AATGGGCCCCTCAAGCGTTCTTTACTGGTGACATTGCAAATAACTTGGAGCCTGAGTTGG
CCCGTGCTTCTAAGATCAAATGCAGTGTTTGTGGACTAAAAGGTGCAGCCCTTGGCTGCC
TTGTCAAGAGCTGCCGCAAGAGCTTTCATGTTCCATGTGCCCATGGGATATCAGGCTGCC
GATGGGATGATGAGAACTTTGTTATGCTGTGTCCTTCTCATTCCTCGAAGAAGTTGCCAT
GTGAGAGATCAAAGTCAAAAAATAAGAAGACCAGCTTGCAGCGATCATCTTCCGATACAA
TGCTTGATGACCTGAACTCACCATCTACAATCCATATGGATGGACTTTGGACTGCTTCAC
CTTTTCTCACTAGTGAATGGGTTATATGTGGATCTGCTCTCTCTAGTCAGGAGAAGGAAA
TCTTGGACCAGTTTGAGCACCAAACTGGCATCACTGTAACTAACGGTTGGAGGTCGAATG
TGACTCATGTGATTGCTAATACGGATGAATGTGGGGCATGTGCCAGGACACTCAAGGTTC
TCATGGCCATACTAGCTGGGAAATGGGTTCTGAATATAAACTGGCTGAAAGCTTGTATGG
AGGCTAAAGAACCAGTCCCAGAAGAGCCTTATGAGATCAGTTCTGATGTTCATGGCTCCT
TTGATGGCCCTCGCATGGGAAGACTACGAGCAATGCAAAATGCACCACATCTGTTTGCAG
GATTGACCTTTTACTTCAGTGGCCATTTCATGCCCAATTACAAGGTTCACCTTGAAGATT
TGATCACTGCAGCTGGGGGATCAATCTTGGACAAGGCTGATCTCTCTAGCACATCCTTGA
TAATTTACAGCATGGAGCCACCACAAGGAAGTGATCCTGATACCCTTAATGAGGTCATCA
GAAAGAGGAAGGCTGAGGCTGAAGAATTGGCGGCAACGATTGGCTCCAGGGCTGTTCCTC
ATACATGTGTTCTGGATTCTATTGCATCATGCACAGTGCAATTGACCATGTGATGCTGTA
TCTTAGGTTAGGAGTTAGGATGTTACTGATATGTTCTTGAGTGAAAATATCTTCTAGATG
TTGTAAGTTGTAACGTGAGCAAGCAATTTAATTCAAATAATATTGATATGTCTCTTTCC

CDS

1890 bp

>Os04t0512400-01 Similar to Midline 1 protein (Tripartite motif protein 18).
ATGGAGAGCTTCAGGAGGTTCCTGAACCCGCTGGTGCTCAACCTGCAGAAGATGGAGCTG
GAGCTCACCTGCCCCGTCTGCCTGAAGTTGCTCAACGCGCCTACCATGCTGCCATGTTAC
CACACTTCCTGCAGCAAGTGTGCTACTACACGGACCATGGACGGTTACAGCTGCGCGATT
TGCAAATCAGCTTATCGTTCTCAAGACCTAAGGCCTGCCTCTCACCTCGAGGCAATAGTG
AACATCCACAGGAGCCTAAGCTCTACAGTCAGCAGCATGGTCACTCAGCAGGAGGCTCAA
GCTGATATTCCTGTTGCAAAGACATCATTTCAAGGAACTCCAGAATCGGGAAACAGAAAT
GGAGCAGAGAAATCTGATCAGGTGAAATCATACACCCCGGTTGCTTCTAAACTGGCATAT
AACCAGTCAACTGGGCTTGCATATGGAAATGTGGACGGCGTGAAAGAAAGAAATCCTGCA
TTGGAGACTAGAGGTGCGGCTGATGTGACTGCTATGCCCACAATTCTTGTGCAGAAGGGA
CCCTGCCGATCTCAATCTTCTGATGGCCCTAGGGATCTGGATTGCGACAGCAATGACCTT
GAAGGAGAGCTGATAACAAGCAGATCATCTCCTCAAAGTGTCTTGAAAAGAGAACCAAAT
ACAGCGAATGATGATAATAGAGAATTAAAAAGGCAAAAGTCCACTGATCAGGATGATAGA
CAACCAGCTGTTGCTGGTGCTTGGAAATGTGAATTTTGTCACTCTTCCAAAACCACTGAG
AGTACTGGCCCTCTGTCCCATTATCTGCATGGTGAGCCATTAGAGGATAACCAAGCATGG
AAACCAAACGTTTTACATGTTCATGAGAAGTGCATTGAATGGGCCCCTCAAGCGTTCTTT
ACTGGTGACATTGCAAATAACTTGGAGCCTGAGTTGGCCCGTGCTTCTAAGATCAAATGC
AGTGTTTGTGGACTAAAAGGTGCAGCCCTTGGCTGCCTTGTCAAGAGCTGCCGCAAGAGC
TTTCATGTTCCATGTGCCCATGGGATATCAGGCTGCCGATGGGATGATGAGAACTTTGTT
ATGCTGTGTCCTTCTCATTCCTCGAAGAAGTTGCCATGTGAGAGATCAAAGTCAAAAAAT
AAGAAGACCAGCTTGCAGCGATCATCTTCCGATACAATGCTTGATGACCTGAACTCACCA
TCTACAATCCATATGGATGGACTTTGGACTGCTTCACCTTTTCTCACTAGTGAATGGGTT
ATATGTGGATCTGCTCTCTCTAGTCAGGAGAAGGAAATCTTGGACCAGTTTGAGCACCAA
ACTGGCATCACTGTAACTAACGGTTGGAGGTCGAATGTGACTCATGTGATTGCTAATACG
GATGAATGTGGGGCATGTGCCAGGACACTCAAGGTTCTCATGGCCATACTAGCTGGGAAA
TGGGTTCTGAATATAAACTGGCTGAAAGCTTGTATGGAGGCTAAAGAACCAGTCCCAGAA
GAGCCTTATGAGATCAGTTCTGATGTTCATGGCTCCTTTGATGGCCCTCGCATGGGAAGA
CTACGAGCAATGCAAAATGCACCACATCTGTTTGCAGGATTGACCTTTTACTTCAGTGGC
CATTTCATGCCCAATTACAAGGTTCACCTTGAAGATTTGATCACTGCAGCTGGGGGATCA
ATCTTGGACAAGGCTGATCTCTCTAGCACATCCTTGATAATTTACAGCATGGAGCCACCA
CAAGGAAGTGATCCTGATACCCTTAATGAGGTCATCAGAAAGAGGAAGGCTGAGGCTGAA
GAATTGGCGGCAACGATTGGCTCCAGGGCTGTTCCTCATACATGTGTTCTGGATTCTATT
GCATCATGCACAGTGCAATTGACCATGTGA

Protein

630 aa

>Os04t0512400-01 Similar to Midline 1 protein (Tripartite motif protein 18).
MESFRRFLNPLVLNLQKMELELTCPVCLKLLNAPTMLPCYHTSCSKCATTRTMDGYSCAI
CKSAYRSQDLRPASHLEAIVNIHRSLSSTVSSMVTQQEAQADIPVAKTSFQGTPESGNRN
GAEKSDQVKSYTPVASKLAYNQSTGLAYGNVDGVKERNPALETRGAADVTAMPTILVQKG
PCRSQSSDGPRDLDCDSNDLEGELITSRSSPQSVLKREPNTANDDNRELKRQKSTDQDDR
QPAVAGAWKCEFCHSSKTTESTGPLSHYLHGEPLEDNQAWKPNVLHVHEKCIEWAPQAFF
TGDIANNLEPELARASKIKCSVCGLKGAALGCLVKSCRKSFHVPCAHGISGCRWDDENFV
MLCPSHSSKKLPCERSKSKNKKTSLQRSSSDTMLDDLNSPSTIHMDGLWTASPFLTSEWV
ICGSALSSQEKEILDQFEHQTGITVTNGWRSNVTHVIANTDECGACARTLKVLMAILAGK
WVLNINWLKACMEAKEPVPEEPYEISSDVHGSFDGPRMGRLRAMQNAPHLFAGLTFYFSG
HFMPNYKVHLEDLITAAGGSILDKADLSSTSLIIYSMEPPQGSDPDTLNEVIRKRKAEAE
ELAATIGSRAVPHTCVLDSIASCTVQLTM*

5'UTR

chr04:25615442..25615824 (- strand) : 383 bp

CDS

chr04:25615362..25615441 (- strand) : 80 bp

chr04:25615094..25615147 (- strand) : 54 bp

chr04:25614939..25615009 (- strand) : 71 bp

chr04:25614751..25614858 (- strand) : 108 bp

chr04:25614324..25614622 (- strand) : 299 bp

chr04:25614032..25614137 (- strand) : 106 bp

chr04:25613888..25613949 (- strand) : 62 bp

chr04:25613683..25613783 (- strand) : 101 bp

chr04:25613309..25613495 (- strand) : 187 bp

chr04:25613097..25613188 (- strand) : 92 bp

chr04:25612865..25612997 (- strand) : 133 bp

chr04:25612599..25612764 (- strand) : 166 bp

chr04:25612197..25612315 (- strand) : 119 bp

chr04:25611799..25612110 (- strand) : 312 bp

3'UTR

chr04:25611673..25611798 (- strand) : 126 bp

FASTA

>Os04t0512400-01 class=Sequence position=chr04:25611673..25615824 (- strand)
GGGGGCGCGC GCCTGCGCGC CTCTCTCCCG CAGTCCCGCC CGCCCGCGCG CGCGCGCGGC GCTCGAAACA GGCAATCGCT
TTCCCCATCC AAAACCAGTC CACCCTCGCG CCGCGGGGGA AAACCCCGAA AAATTTTCTT CTTCCCGCCG ATGGCACGCC
GGTTCAGACC CGCGCCCGCA CGCGGCGGCA TCCAAACATT TTTTTTCCAG CCGCCGCCAC CCCTTCCCTC CAATTTTCGA
GCGTGGCCAC GCGTATTTCA GTGGCTCCGG AGCTAGCTTA ATTAGCAGTG CCCACAAGCC ACCGTCTCCG CAGTCCGCAC
ACAGGTTCTT CAATCCTTTG AGAGAGAGCG AGAGCGAGAG CGAGACCGTG CGGCCGTGCA GGGATGGAGA GCTTCAGGAG
GTTCCTGAAC CCGCTGGTGC TCAACCTGCA GAAGATGGAG CTGGAGCTCA CCTGCCCCGT CTGGTACGCG CCTTCTCTTC
TCTTGAGCTC CCTCTCCTTT GGATCCAGAT GAAAGAACAG ATCCTGGGCA ATCAATCAGG CTAGCTAGGT TGGTGTTAGT
TTAGATCTGC GTAATACTGC CGGATCTGAA CTTGTTTACC ATAATAAGAC GTCAAATGAA AATATTTTGA TTGCTGATAT
TTCCGGTCTT CTCATGGCAT TGTCTTTTGC TCGGCAGCCT GAAGTTGCTC AACGCGCCTA CCATGCTGCC ATGTTACCAC
ACTTCCTGCA GGTTATTTAC AAATACCTGA ACTGATATGA ATTGTATTTT GATCTACGCA TCTGGTCTTG TGACTAATTT
GTTGAATCCT TTCAGCAAGT GTGCTACTAC ACGGACCATG GACGGTTACA GCTGCGCGAT TTGCAAATCA GCTTATCGTT
CTCAAGGTGA CATCATGCCA GACTGAAATG TTACAAGCAT CAGACCAATG CTTTGATTCT TTATCTGACC TTAACATGGC
TTGCAGACCT AAGGCCTGCC TCTCACCTCG AGGCAATAGT GAACATCCAC AGGAGCCTAA GCTCTACAGT CAGCAGCATG
GTCACTCAGC AGGAGGCTCA AGCTGATATT CCTGGTACAT ACTCTGCCAG TTATTTGCCC CCTAAATTCA CAGAATATCT
ACATCGGAAA CAAAATACTT CGCACTGATA GTTGTATAAG GTCGAATGCT GATTACGCTG GTAAAATATT TCTTCTGTTC
AGTTGCAAAG ACATCATTTC AAGGAACTCC AGAATCGGGA AACAGAAATG GAGCAGAGAA ATCTGATCAG GTGAAATCAT
ACACCCCGGT TGCTTCTAAA CTGGCATATA ACCAGTCAAC TGGGCTTGCA TATGGAAATG TGGACGGCGT GAAAGAAAGA
AATCCTGCAT TGGAGACTAG AGGTGCGGCT GATGTGACTG CTATGCCCAC AATTCTTGTG CAGAAGGGAC CCTGCCGATC
TCAATCTTCT GATGGCCCTA GGGATCTGGA TTGCGACAGC AATGACCTTG AAGGAGAGCT GGTAATATTC TATCTAAGCA
ACTCCATTGC TAAAAAAACC TTGTCTTTGG GCATTCATTA ATTGAATTCG GATGTCTGAA TCTTGGAGCT GAACTAGTTC
AAGTCTAATG AATGTTCTGA AAATTTTCCT TTGCATGTGC TAACTTATTT TTAAATCTCA CGCATGATGC ATGTATCATT
CTGATAGATA ACAAGCAGAT CATCTCCTCA AAGTGTCTTG AAAAGAGAAC CAAATACAGC GAATGATGAT AATAGAGAAT
TAAAAAGGCA AAAGTCCACT GATCAGGATG ATAGTAAGTC TTCTTTTCAA ACTGCTCTCC TTTCTGATTA GTTAGAATTG
CAAGGTCACT AATGCATATG CAATCGTTGA TACAGGACAA CCAGCTGTTG CTGGTGCTTG GAAATGTGAA TTTTGTCACT
CTTCCAAAAC CACTGAGGTA AGTCAAATGG CAAAACCTGA ACATTGTCTT TTTCACTATT CAGGACATGC CTTGGATTGC
TTTTCTATTT CAAGAATCTA ATATAAAGTT GGAATTAACA GAGTACTGGC CCTCTGTCCC ATTATCTGCA TGGTGAGCCA
TTAGAGGATA ACCAAGCATG GAAACCAAAC GTTTTACATG TTCATGAGAA GTGCATTGAA TGGTATGCTC CATCCAGCTT
ATGAGCTTAT TTTTCCTAAA TGAATACATA ATTTTATTTG AGTTGTAAAC CGATAAAATT AAGTTTGTAT TTTTATATGC
TTTTTTAGAC TGAAGCATGT TTATCTAGCT AGAATATCAC CTATAATTCC TTATACTTTT TAATATTGAA GTTACTGATA
CCAATGTAGG GCCCCTCAAG CGTTCTTTAC TGGTGACATT GCAAATAACT TGGAGCCTGA GTTGGCCCGT GCTTCTAAGA
TCAAATGCAG TGTTTGTGGA CTAAAAGGTG CAGCCCTTGG CTGCCTTGTC AAGAGCTGCC GCAAGAGCTT TCATGTTCCA
TGTGCCCATG GGATATCAGG CTGCCGATGG GATGATGTAA ATATTTCTTT AACCTTGCAC TGTCCATTCT TTTTACAGTC
TGAATGCATG TCTTTATTTG TGGCACAAAA TTATGTGAAT AAGTGAATTC ATCTCATCAA ATGTACTGTG TTTTAGGAGA
ACTTTGTTAT GCTGTGTCCT TCTCATTCCT CGAAGAAGTT GCCATGTGAG AGATCAAAGT CAAAAAATAA GAAGACCAGC
TTGCAGCGGT TTGTTCTCTA GTCCTGTTCA TTGTAACTGC ATTTTGCTAT ACCTTCATGG CTGCACATAT CCTTAAGTTG
AACCTTTTCC CTTTCTTGAT TTGCCAGATC ATCTTCCGAT ACAATGCTTG ATGACCTGAA CTCACCATCT ACAATCCATA
TGGATGGACT TTGGACTGCT TCACCTTTTC TCACTAGTGA ATGGGTTATA TGTGGATCTG CTCTCTCTAG TCAGGAGAAG
GTGATTAATA GTTATCTCTT ATCTAATTAC AATTTCAACA GGCTATTGCA TGATTTGGTT GTTTCAAAAA TGTAAACTTT
CTTTGTTTGG AACTTGACAG GAAATCTTGG ACCAGTTTGA GCACCAAACT GGCATCACTG TAACTAACGG TTGGAGGTCG
AATGTGACTC ATGTGATTGC TAATACGGAT GAATGTGGGG CATGTGCCAG GACACTCAAG GTTCTCATGG CCATACTAGC
TGGGAAATGG GTTCTGAATA TAAACTGTAA GTTCAATGCC TCTGAAAATT AAGACCTGGG TTTACCTGGG GATAATGGTT
TCTGCTCTTG TGCTTTTCTA ACACATCCTT TGTCATCTTT TAGAAATTAG ACAATAGCTG ATGGATTTTG TCACTTCTTA
CATGTAGTTC TCTTTTCATA CGCTTAAAAT AAGTTGAGCA TGCTTACCAC ATGAATATTT TTATGCTTGC ATTTACAATG
GTTGCTCCAT TGTAAATACC CTCTTCTGCT AGGAAGTTTC TCTGATTCAT GTTATTGTGT AATATTTAGG GCTGAAAGCT
TGTATGGAGG CTAAAGAACC AGTCCCAGAA GAGCCTTATG AGATCAGTTC TGATGTTCAT GGCTCCTTTG ATGGCCCTCG
CATGGGAAGA CTACGAGCAA TGCAAAATGT GTGTATAAAT TCACTGAGTA AATAAGTCAA AGTACAAGTT CAATCTTCAT
GGAGTATTGA TCCCATGTGT TTCTTGTTTT CTAGGCACCA CATCTGTTTG CAGGATTGAC CTTTTACTTC AGTGGCCATT
TCATGCCCAA TTACAAGGTT CACCTTGAAG ATTTGATCAC TGCAGCTGGG GGATCAATCT TGGACAAGGC TGATCTCTCT
AGCACATCCT TGATAATTTA CAGCATGGAG CCACCACAAG GAAGTGATCC TGATACCCTT AATGAGGTCA TCAGAAAGAG
GAAGGCTGAG GCTGAAGAAT TGGCGGCAAC GATTGGCTCC AGGGCTGTTC CTCATACATG TGTTCTGGAT TCTATTGCAT
CATGCACAGT GCAATTGACC ATGTGATGCT GTATCTTAGG TTAGGAGTTA GGATGTTACT GATATGTTCT TGAGTGAAAA
TATCTTCTAG ATGTTGTAAG TTGTAACGTG AGCAAGCAAT TTAATTCAAA TAATATTGAT ATGTCTCTTT CC