Os04t0515900-01

Locus

Os04g0515900

Description

Similar to NAM / CUC2-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

ONAC008, ONAC8

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 008, NAC domain-containing protein 8

Transcript Evidence

AK062955 (DDBJ, Best hit)

Protein Evidence

NP_001150296.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

001-109-C12 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0515900-01)

RiceXPro (AK062955)

Others

Oryzabase (11460)

KEGG (Os04t0515900-01)

Transcript

1287 bp

>Os04t0515900-01 Similar to NAM / CUC2-like protein.
AAAATTTACACCTATATCTATCTATATTTCTCGTTTGTGCTCGGGCTAGCTCACCATATG
CGTAAAATTCTGTAGCCAAAAGGAGCAAGCAAACTAGGAGGAGGATTAGTTCTTGCGCAT
CGCTTCTGAGCTCGATCTACGTCGTCCGGCCGGCCgggagggatcgatcgatgggtctga
gggagatcgagtcgacattgccgccggggttcaggttctacccgagcgacgaggagctgg
tctgccactacctctacaagaaggtgtccaacgagcgcgcctcgcaggggacgctggtgg
aagtcgacctccatgcgcgcgagccatgggagcttcccgacgtggcgaagctgacggcga
gcgagtggtacttcttcagcttcagggaccgaaagtacgcgacggggtcgcgcacgaacc
gcgccaccaagacaggctactggaaggccaccggcaaggaccgcgaggtgcgcagcccgg
ccacgcgcgccgtcgtcggcatgcggaagacgctcgtcttctaccagggccgcgccccca
acggcgtcaagtccggctgggtcatgcacgagttccgcctcgactcgccgcattctccac
caaagGAGGATTGGGTGCTTTGCAGGGTGTTTCAGAAGAGCAAGGGAGACGGCGAGCAAG
ACAACCCCACCAGCGCAGCCTCCCCGGCGGCGACCTTCGCCGGCTCGTCGCAGGCGGCGG
TGCCTGGCCAAGCCGCGTACAGCAGCGACGACCATACGGGCTCGTCGATGGGATTCGCGC
CGAGGCAGAACGAGATACTCGACAGCTCGAGCCATCAGTTGCTGAACTTGGCGATGCTGC
AGTGCAACTCGGTTCTCGATCATTTCCCGCAGGAGGTGAACAGCTCGCCGATGATGGGGT
TGGCAGGGTCCATCGGAATTGGGGATGAATACGGCTTCTTCTACGATACCGGCTTCGAGG
AGACGGCGAGCCTCGGGGGCATGAGGTTCCCACAAGGGTGGAGTTGATGCCAATTGATCG
TGCATGCAGTGAGATCATCGTGCCTGCGCGCATTTGCGAAGGAAAATGATTGAATTAATT
CCATTGATACAGTTATTTCGTCCTAAAAAAATAAACTATTGCTACTGTAGGTAGTGTTTG
GTTTAGCATAGAACCTGCATGAGATGGTTCGGTCACTTGAACTGTATATATATTGTGTGA
GTCAAAATGTATCGCTCTACTCGTATGCAAGTTGATACAATCCATCCCAAAGTTCCAGTT
CATAGATCAAACGATCTATGAGCTATC

CDS

837 bp

>Os04t0515900-01 Similar to NAM / CUC2-like protein.
atgggtctgagggagatcgagtcgacattgccgccggggttcaggttctacccgagcgac
gaggagctggtctgccactacctctacaagaaggtgtccaacgagcgcgcctcgcagggg
acgctggtggaagtcgacctccatgcgcgcgagccatgggagcttcccgacgtggcgaag
ctgacggcgagcgagtggtacttcttcagcttcagggaccgaaagtacgcgacggggtcg
cgcacgaaccgcgccaccaagacaggctactggaaggccaccggcaaggaccgcgaggtg
cgcagcccggccacgcgcgccgtcgtcggcatgcggaagacgctcgtcttctaccagggc
cgcgcccccaacggcgtcaagtccggctgggtcatgcacgagttccgcctcgactcgccg
cattctccaccaaagGAGGATTGGGTGCTTTGCAGGGTGTTTCAGAAGAGCAAGGGAGAC
GGCGAGCAAGACAACCCCACCAGCGCAGCCTCCCCGGCGGCGACCTTCGCCGGCTCGTCG
CAGGCGGCGGTGCCTGGCCAAGCCGCGTACAGCAGCGACGACCATACGGGCTCGTCGATG
GGATTCGCGCCGAGGCAGAACGAGATACTCGACAGCTCGAGCCATCAGTTGCTGAACTTG
GCGATGCTGCAGTGCAACTCGGTTCTCGATCATTTCCCGCAGGAGGTGAACAGCTCGCCG
ATGATGGGGTTGGCAGGGTCCATCGGAATTGGGGATGAATACGGCTTCTTCTACGATACC
GGCTTCGAGGAGACGGCGAGCCTCGGGGGCATGAGGTTCCCACAAGGGTGGAGTTGA

Protein

279 aa

>Os04t0515900-01 Similar to NAM / CUC2-like protein.
MGLREIESTLPPGFRFYPSDEELVCHYLYKKVSNERASQGTLVEVDLHAREPWELPDVAK
LTASEWYFFSFRDRKYATGSRTNRATKTGYWKATGKDREVRSPATRAVVGMRKTLVFYQG
RAPNGVKSGWVMHEFRLDSPHSPPKEDWVLCRVFQKSKGDGEQDNPTSAASPAATFAGSS
QAAVPGQAAYSSDDHTGSSMGFAPRQNEILDSSSHQLLNLAMLQCNSVLDHFPQEVNSSP
MMGLAGSIGIGDEYGFFYDTGFEETASLGGMRFPQGWS*

5'UTR

chr04:25773347..25773516 (+ strand) : 170 bp

CDS

chr04:25773517..25773685 (+ strand) : 169 bp

chr04:25775129..25775394 (+ strand) : 266 bp

chr04:25775502..25775903 (+ strand) : 402 bp

3'UTR

chr04:25775904..25776183 (+ strand) : 280 bp

FASTA

>Os04t0515900-01 class=Sequence position=chr04:25773347..25776183 (+ strand)
AAAATTTACA CCTATATCTA TCTATATTTC TCGTTTGTGC TCGGGCTAGC TCACCATATG CGTAAAATTC TGTAGCCAAA
AGGAGCAAGC AAACTAGGAG GAGGATTAGT TCTTGCGCAT CGCTTCTGAG CTCGATCTAC GTCGTCCGGC CGGCCgggag
ggatcgatcg atgggtctga gggagatcga gtcgacattg ccgccggggt tcaggttcta cccgagcgac gaggagctgg
tctgccacta cctctacaag aaggtgtcca acgagcgcgc ctcgcagggg acgctggtgg aagtcgacct ccatgcgcgc
gagccatggg agcttcccgg tgagtcatGA ATTAATATAT CCTGCATGTT GCTGCTAATT CTCATCGTTC TATATATCTC
TCCCCTCGAT CTCGCACAGG TTGCTTTATC ACTAGTAACT CTTATGTTAG CATGTTTCCG GATTAGATAT ATAGATCATA
GATGTGATGA TCTCGATCGA GATGCTTACA GAAAACAGCA AAAACCATGC ATCTGATTTT CTTCATGATG CGATAGGCTA
GCAGATTAAT TAGCATGCTC TGTTCCATTG AAGATATATT TGCAAAAAAA AAAAAAGCTT GCCCCTTTAA TTTGGTAGCA
CCGTAGCAGC AAGTACTGAT GATGTCACAA TTATAATGAT GAACAAGAAA ATAACTACCT GATCGAAGAA TTTTCTACTT
AGTATATATA TTTGAATTAT TTTAACTTGA ATGAATCCTA AAGATTCGAT TTCTGTCAGT TAATGGCCTT GAGCTCCATA
ATTTATCACG GAATAATCCA CAATAATTTC GTCCAATAAT ACATTAACTG ATACGAAAGC AAAGTGTTAT ACTCGTCGCC
ATCTTGATGA CGACTCCGAT ACCGTCTGTT TCTTTGCTAC GTCACATGAG TAACAGTTCC TTCCGTTTTT CTGTTCCTTT
TTTCTCTGAA AAACCATTTC CCTTTTTCCT CCAGAAATTA GTTCAGTTTG AGCACTTTAC GGCCGTCAAT CTAAACTCTC
CTCGGTGTAT CAGAACGGAT TTGCTAGTTT ACTGGCGACA GTAAACGAGG GGAAAAACTG CCGAATTTTT GAACGTCGGA
TTCGCCTCAA GATTAGTGCT GGCGCGTTCG TGCAAAAGAT CCACGCGATA TGTAAAGAAA AACTGCCGAA TTTTTGAACG
TCGGATTCGC CTCAAGATTA GTGCTGGCGC GTTCGTGCAA AAGATCCACG CGATATGTAA AGAAAAACTG CCGAATTTTT
GAACGTCGGA TTCGCCTCAA GATTAGTGCT GGCGCGTTCG TGCAAAAGAT CCACGCGATA TGTAAATTTG TGTGTTGCAT
GGGGTTCGAA CCCAGGACTT CAATCCCACT AGCTATGCGT GGTAGCCACT TCGTCTCATG CAAGTTTTTT AAAAAGtttg
caagttacag ttagttatac tccagttaca ctctagttac attgtagtta ccattgtaac tatagtgtaa ctacactata
actatattgt tatctctata taaattagat ataaagttgc atatatTATT TTAATACATA TATACAAGTT ATTATTATTA
TAGTATATAA TTCTAGTAAA ATTTCCCCTC AAAAAACACT CGACAGTTTT TTAGCTAATC CCTATCAGAA ATTAGTTTCA
CTTCATGTAT GCAAAGCCAG ACTAATTCGC ATGCACTATC TCAACTTCTC AAGCCCCTCT CTAACAACGC ATTCGTTCTT
GCTATTCTTT GCGCAcatgc agacgtggcg aagctgacgg cgagcgagtg gtacttcttc agcttcaggg accgaaagta
cgcgacgggg tcgcgcacga accgcgccac caagacaggc tactggaagg ccaccggcaa ggaccgcgag gtgcgcagcc
cggccacgcg cgccgtcgtc ggcatgcgga agacgctcgt cttctaccag ggccgcgccc ccaacggcgt caagtccggc
tgggtcatgc acgagttccg cctcgactcg ccgcattctc caccaaaggt acgtacatag cacgAGCTAG CTCTTCTCTC
TACCCGCCAA AACGTGCTAC TTCTTGTTGC CGCTAATTGC TAACCTGGAC ACGGATCGAT ATGCGTTTCT TGCAGGAGGA
TTGGGTGCTT TGCAGGGTGT TTCAGAAGAG CAAGGGAGAC GGCGAGCAAG ACAACCCCAC CAGCGCAGCC TCCCCGGCGG
CGACCTTCGC CGGCTCGTCG CAGGCGGCGG TGCCTGGCCA AGCCGCGTAC AGCAGCGACG ACCATACGGG CTCGTCGATG
GGATTCGCGC CGAGGCAGAA CGAGATACTC GACAGCTCGA GCCATCAGTT GCTGAACTTG GCGATGCTGC AGTGCAACTC
GGTTCTCGAT CATTTCCCGC AGGAGGTGAA CAGCTCGCCG ATGATGGGGT TGGCAGGGTC CATCGGAATT GGGGATGAAT
ACGGCTTCTT CTACGATACC GGCTTCGAGG AGACGGCGAG CCTCGGGGGC ATGAGGTTCC CACAAGGGTG GAGTTGATGC
CAATTGATCG TGCATGCAGT GAGATCATCG TGCCTGCGCG CATTTGCGAA GGAAAATGAT TGAATTAATT CCATTGATAC
AGTTATTTCG TCCTAAAAAA ATAAACTATT GCTACTGTAG GTAGTGTTTG GTTTAGCATA GAACCTGCAT GAGATGGTTC
GGTCACTTGA ACTGTATATA TATTGTGTGA GTCAAAATGT ATCGCTCTAC TCGTATGCAA GTTGATACAA TCCATCCCAA
AGTTCCAGTT CATAGATCAA ACGATCTATG AGCTATC

Locus: Os04g0515900

Loading...

Locus: Os04g0515900

Loading...