Os04t0517300-01

Locus

Os04g0517300

Description

Protein of unknown function DUF647 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RUS2

CGSNL Gene Name

ROOT UV-B SENSITIVE 2

Oryzabase Gene Symbol Synonym(s)

OsRUS2, OsRUS2.1, OsRUS2.2

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK069879 (DDBJ, Best hit)

Protein Evidence

Q01J52 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Protein of unknown function DUF647 (IPR006968)

Full-length cDNA

J023036K12 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0517300-01)

RiceXPro (AK069879)

Others

Oryzabase (21448)

KEGG (Os04t0517300-01)

Transcript

1662 bp

>Os04t0517300-01 Protein of unknown function DUF647 family protein.
GAGGAGCAAAAATTCCGGTGGAAACACGTCCGTCGCCCGTGACGAGGTGGAAACCCAAAA
CCTCGTCGGCGGCTTCCCCAATCCCCTCCCTCCGCCGCCGCCGTCTCGGTCTCGCCGGAT
AAGGAGGAGGAGGAGAGGAGATCGCCGGCGAGTCCCTCCCGAATGAACATACTCGAGAGG
ATACGCGGAGGCGGCGACAGGGCGGCCGTGGGGGAGGGGCCGCGGGAGCCGGAGCCATGG
GTGGAGATTTCGGAGTCCATCTCTCGGCTCTGCAGCTTCGACGCCGGCAGAGTCTCTGTA
AAAGTTATCCAAGATTCGAGACCAATACATGATAAGATGATCGATTCTTTCTTGAACAAA
TTTTTTCCATCAGGCTATCCATACAGTGTGAATGAGGGTTACCTAACTTACACCAAATTC
CGAGCGCTCCAGCATTTTTCTAGTGCTATGCTGCATGTGCTATCAACCCAGTCTTTGTTG
TTTGCTGCAGGTTTGCGACCTACCCCTGCACAAGCAACTGCTGTAAGTTGGATTCTAAAA
GATGGAATGCAGCACGCAGGAAAGCTCATATGTAGTGGCATGGGGGCAAGAATGGATTCA
GAGCCAAAGAGTTGGAGGATACTTGCTGATGTTCTCTATGATTTTGGTACTGCCTTAGAA
GTCATTTCACCTTTGTGCCCACAACTTTTTCTTGAAGTAGCAGGCTTCGGAAACTTTGCA
AAGGGAATGGCTGTTGTTGCAGCAAGAGCGACAAGGCTACCAATCTATTCTTCTTTTGCC
AAGGAAGGTAACCTTAGTGACTTATTTGCTAAAGGGGAAGCCATCTCAACACTTTTCAAT
GTCATGGGAATAGGTGCTGGCATTGGATTAGCATCTACGGTGTGCTCAACAACTCAAGGG
AAGTTAATTGCAGGCCCATTGCTTTCTGTTGTACATATATATGGAGTTGTGCAAGAGATG
AGGGCAACTCCTGTAAACACACTTAATCCGCAAAGAACAGCAATGATTGTTGCTGATTTT
ATCAAGAGTGGAAAGGTTTCCAGCCCAGCTGAGCTAAGATATCGAGAAGATCTTCTTTTT
CCTAACCGATTAATAGAAGAAGCAGGAAGTGTGAAAATTGGACAACCAGTCCGCAGAGTT
CTTAGCCCACAGCGTATCGAACAGCTGAAAGCAACTTTCTCAAAGGAGAAATTTTTGCTT
AGTCGAAAAGACAACAGTGCATACATGGTTCTTGAGCAGAGTGCAACGGGAGAAGATGCA
CTGAGGGGATGGCTAGTTGCTGCCTTTGCTTCAGAAATGGAAAGATCAGGTGTTGGTTCA
GGTGATACAGTTCTAAATGTAGCCTACGAGAGGATGGAGAATGTGTTCCCCATGTTTGTG
GCAGAAGTTAAGAGTAGAGGCTGGTACACAGATCAATTTTTAGACGGAAATCGGAGTCGA
ATTGCATATGCAAATCCCATCAGCGGTAGTGCTTTATGACAACAATTTTCGGAGTTGAAG
AGATGAGCAGATAACTTATTTTTCACTTTGCATTGTTTGTAAAACATTTGTTTTAATGAA
ATAGGCCCATCGTGTCTTGAGTATAGACATGGTAAATGTATCACTGAATCGAGTGAATGC
TTTCTGACGGCCAGAATTTAAATCGATAGCAACTGCTAGTTC

CDS

1317 bp

>Os04t0517300-01 Protein of unknown function DUF647 family protein.
ATGAACATACTCGAGAGGATACGCGGAGGCGGCGACAGGGCGGCCGTGGGGGAGGGGCCG
CGGGAGCCGGAGCCATGGGTGGAGATTTCGGAGTCCATCTCTCGGCTCTGCAGCTTCGAC
GCCGGCAGAGTCTCTGTAAAAGTTATCCAAGATTCGAGACCAATACATGATAAGATGATC
GATTCTTTCTTGAACAAATTTTTTCCATCAGGCTATCCATACAGTGTGAATGAGGGTTAC
CTAACTTACACCAAATTCCGAGCGCTCCAGCATTTTTCTAGTGCTATGCTGCATGTGCTA
TCAACCCAGTCTTTGTTGTTTGCTGCAGGTTTGCGACCTACCCCTGCACAAGCAACTGCT
GTAAGTTGGATTCTAAAAGATGGAATGCAGCACGCAGGAAAGCTCATATGTAGTGGCATG
GGGGCAAGAATGGATTCAGAGCCAAAGAGTTGGAGGATACTTGCTGATGTTCTCTATGAT
TTTGGTACTGCCTTAGAAGTCATTTCACCTTTGTGCCCACAACTTTTTCTTGAAGTAGCA
GGCTTCGGAAACTTTGCAAAGGGAATGGCTGTTGTTGCAGCAAGAGCGACAAGGCTACCA
ATCTATTCTTCTTTTGCCAAGGAAGGTAACCTTAGTGACTTATTTGCTAAAGGGGAAGCC
ATCTCAACACTTTTCAATGTCATGGGAATAGGTGCTGGCATTGGATTAGCATCTACGGTG
TGCTCAACAACTCAAGGGAAGTTAATTGCAGGCCCATTGCTTTCTGTTGTACATATATAT
GGAGTTGTGCAAGAGATGAGGGCAACTCCTGTAAACACACTTAATCCGCAAAGAACAGCA
ATGATTGTTGCTGATTTTATCAAGAGTGGAAAGGTTTCCAGCCCAGCTGAGCTAAGATAT
CGAGAAGATCTTCTTTTTCCTAACCGATTAATAGAAGAAGCAGGAAGTGTGAAAATTGGA
CAACCAGTCCGCAGAGTTCTTAGCCCACAGCGTATCGAACAGCTGAAAGCAACTTTCTCA
AAGGAGAAATTTTTGCTTAGTCGAAAAGACAACAGTGCATACATGGTTCTTGAGCAGAGT
GCAACGGGAGAAGATGCACTGAGGGGATGGCTAGTTGCTGCCTTTGCTTCAGAAATGGAA
AGATCAGGTGTTGGTTCAGGTGATACAGTTCTAAATGTAGCCTACGAGAGGATGGAGAAT
GTGTTCCCCATGTTTGTGGCAGAAGTTAAGAGTAGAGGCTGGTACACAGATCAATTTTTA
GACGGAAATCGGAGTCGAATTGCATATGCAAATCCCATCAGCGGTAGTGCTTTATGA

Protein

439 aa

>Os04t0517300-01 Protein of unknown function DUF647 family protein.
MNILERIRGGGDRAAVGEGPREPEPWVEISESISRLCSFDAGRVSVKVIQDSRPIHDKMI
DSFLNKFFPSGYPYSVNEGYLTYTKFRALQHFSSAMLHVLSTQSLLFAAGLRPTPAQATA
VSWILKDGMQHAGKLICSGMGARMDSEPKSWRILADVLYDFGTALEVISPLCPQLFLEVA
GFGNFAKGMAVVAARATRLPIYSSFAKEGNLSDLFAKGEAISTLFNVMGIGAGIGLASTV
CSTTQGKLIAGPLLSVVHIYGVVQEMRATPVNTLNPQRTAMIVADFIKSGKVSSPAELRY
REDLLFPNRLIEEAGSVKIGQPVRRVLSPQRIEQLKATFSKEKFLLSRKDNSAYMVLEQS
ATGEDALRGWLVAAFASEMERSGVGSGDTVLNVAYERMENVFPMFVAEVKSRGWYTDQFL
DGNRSRIAYANPISGSAL*

5'UTR

chr04:25859870..25860031 (- strand) : 162 bp

CDS

chr04:25859858..25859869 (- strand) : 12 bp

chr04:25859662..25859784 (- strand) : 123 bp

chr04:25859076..25859164 (- strand) : 89 bp

chr04:25858913..25858997 (- strand) : 85 bp

chr04:25858653..25858712 (- strand) : 60 bp

chr04:25858477..25858570 (- strand) : 94 bp

chr04:25858250..25858347 (- strand) : 98 bp

chr04:25857857..25858036 (- strand) : 180 bp

chr04:25856385..25856507 (- strand) : 123 bp

chr04:25855861..25856313 (- strand) : 453 bp

3'UTR

chr04:25855678..25855860 (- strand) : 183 bp

FASTA

>Os04t0517300-01 class=Sequence position=chr04:25855678..25860031 (- strand)
GAGGAGCAAA AATTCCGGTG GAAACACGTC CGTCGCCCGT GACGAGGTGG AAACCCAAAA CCTCGTCGGC GGCTTCCCCA
ATCCCCTCCC TCCGCCGCCG CCGTCTCGGT CTCGCCGGAT AAGGAGGAGG AGGAGAGGAG ATCGCCGGCG AGTCCCTCCC
GAATGAACAT ACTCGTAAGC TCTCCTCCCA TCTGCTACGG CGCGTCGAGG TGAGAGATCT CATCCTCTGT GCGCGAATCT
TCCGCAGGAG AGGATACGCG GAGGCGGCGA CAGGGCGGCC GTGGGGGAGG GGCCGCGGGA GCCGGAGCCA TGGGTGGAGA
TTTCGGAGTC CATCTCTCGG CTCTGCAGCT TCGACGCCGG CAGAGTCTCT GTAATCCTTC TCCTTTCTCC ATTTCAATGT
TGATTATGCT GAACTTAACA CGTTATGGCT TTATTCACCT ACTGCAATCT TCGCCCAAGT GATAGTACTA GTATATTTTG
ATACTAACGC GAATGAACTA ATAGCTGAAT TGTTTCAGAG AAGTCTATTT TGTATGAATA GTAGGCAATT GGTTTCATTG
GTCAAATCAT GCAACATGTC GGAAGTCTGA ACCATATTTA TGCATGCTTG TTCTAACACT ACAAGTCTAC TACGGGTCCA
TTAACCTTGG TATATATTGT TGAGCTCCTG CGCAAGCAAG CAATCCTGTT TTCCCTAGTT ATACACTTCA TAAATTTTCT
ATTATGAGCT TTCGCTACCG GCAAAGTACC TCTAAATGTT TTGTTGGATT AAACAAAAGG GCTAAAATTT TTCTTAATGG
AAGGGATAAA ATGCAGAAAT ATATCCTGTT TTTGTCAATT TGTGTCTTAA CTCATATCTC GTTCTAGGTA AAAGTTATCC
AAGATTCGAG ACCAATACAT GATAAGATGA TCGATTCTTT CTTGAACAAA TTTTTTCCAT CAGGCTATCC ATACAGGTAT
AAGTTTCCTG AAATTGTATT CTCAATGCTT CTGGGTGACA TTCTTTGATA AGTTTTGGCT TCCAATCCGT GCAGTGTGAA
TGAGGGTTAC CTAACTTACA CCAAATTCCG AGCGCTCCAG CATTTTTCTA GTGCTATGCT GCATGTGCTA TCAACCCAGG
TCAGTTACTC CTACTGCTAC TGTATTTTGT TGAGTAGCAT AAAGCATCAA TAGATAAGTC ATGTGTTGAA ATGTTGATTC
CATGAGTTTT TAGGCAGTTT CTGCATCTGG TTGAAATTAA CTGGGCTATT TTACCTCCAC CTTCTTTCTT GAACAAAAAA
GTGCCTTTCA ACTGACTGCC CATATGGGCT GTCGCTCAGT CTTTGTTGTT TGCTGCAGGT TTGCGACCTA CCCCTGCACA
AGCAACTGCT GTAAGTTGGG TAAGTACATG ATGATAAAGA TGCTAAAAAT TCAAATAGGC AATACTACCA TGCATTGGCT
GATTTTCTAT GTTCATTTCA GATTCTAAAA GATGGAATGC AGCACGCAGG AAAGCTCATA TGTAGTGGCA TGGGGGCAAG
AATGGATTCA GAGCCAAAGA GTTGGAGGAT ACTTGGTATG TAGTAATGAC ATGAATTTGT ATCACCCCTT TTCTGATATT
TATGCTCATT TACGTCTTTA TATTTTTTTT CGAGATGCTA CCAACCATGC TATGCAATTA ATGCCTATTT ATGTGTTTTT
TCAGCTGATG TTCTCTATGA TTTTGGTACT GCCTTAGAAG TCATTTCACC TTTGTGCCCA CAACTTTTTC TTGAAGTAGC
AGGCTTCGGA AACTTTGCAA AGGTGCAATT TTAACTTTCA TGATGCATTG CTGATGGCAT GAATATCAAA ATAGTACAAG
TTAGTTCAGG TTTTGTGGGG GAAAAAAGAA CTACCTTTTG TACCTACGTT GTATGAAATA AACAAATTGA ACGATAACAG
AAATTGATAA TCTACTTGAG CAGTTTATTT TGAATGCCTG AAGGTCAGCT ACAAAAATAT TGTTTGCCGT TGCAGGGAAT
GGCTGTTGTT GCAGCAAGAG CGACAAGGCT ACCAATCTAT TCTTCTTTTG CCAAGGAAGG TAACCTTAGT GACTTATTTG
CTAAAGGGGA AGCCATCTCA ACACTTTTCA ATGTCATGGG AATAGGTGCT GGCATTGGAT TAGCATCTAC GGTGTGCTCA
ACAACTCAAG GGAAGGTATG TCACAACAAG GGTGCATCTC TTCAGTTACT TTAGCTTGTA TCATTTGATT AGGCAAATGC
AGAGTGAGAA ATGTCATTAA AAAATGATGC AATTTAGGTT TTCAGAGCAA TATGGCATGA AAAATCTTCT TTCCTATGCT
AAATAAACTT GTCAAAGATA TTTGTTTCAA CTGTATACTC CAGAGATATT TTACCTAGCA TTACCAGGTT CATTAGTTGT
TTTTCCAGAA TGGATCATAG GTTGTAGGGC TGCCATGGTC CCCAATAGGC ATATACTACC AGAACAGCCT GTTAGGCCAT
GCGATATAGT ACACTTATGC TGATTACTGC CCCCCCCCCC CGGGGGGCCC TTTTTTGTTT GTCAACACAT GAGGGTTTTG
GGCTCACGTG GCGACAGAAC CACCAGTTAG TCTTTCCTCA CCTTCTTCCT CTCCCCTCTG TTAAGCATCC TGCAAGCTAG
CCGACTTAAA TAAAGTATGT TCACTATTAC TCGAGCTTGG TGGGATCTCA TGGTGGAGGC AGATCTGGGT GCTCACGAGG
TGGCTGGATG TTTCAAACTC TGGCGTCGCA CCCCTGCAGC CACTGTCGCG TTGCTTCGGC CTGCTATCCA CGCCCTATGG
GGTTGCTGCC ATGCTCCAGT CCGACCCATG ACTAAAACGA GCAAACCAGC AAGCATACCA AACCGAGGGA AGTGAAGTGT
GTCGTCCATC GTCTGCACCA CCACTCGCCA GTCAGCCTTA GCAGCAGTGT AGGGAATTTT CTATTGGAAC CAAGTATTAG
GTAAAAAATA GATGTGGCTT TATTTGGAGT AAATAACCAG GCAGCAAGTG CCATCCGCCA AAACCTGCCC ATTAACAACG
AAGGAACTAG GAGTAGCAAT TTTAATGAGG AGCAATTTAC GTGGTCATTT CTTCATCACT ACAGCATACT ACAGAAGGAA
TGGCCATGCA GAAATAGAGA TAACGACCAA GCCCTTTTTC CATTTGTTGT TAATATTTTG GTTTATAGTT GTGCTGCGGT
TTTCCACAAG CTCGGAGGAT GCCCGGGAGA TGTGGTGGCT GCAATGCTTG CCTGCTCCGG CCCTGACCAG CAGAGAGACA
AGGGAGAACT AGGAGGGAGA AGGTGAATAG GGACTGACAT ATGGGTCCCA CAAGAGTAAA CCACTCCGGA TTTGAAGAGG
GGGGGGGGGT AATTCGTACG GTTTGATAAG TTGAAGGGTG TAAAACGTCC GGTATTATAG TTGAGGGGGT AAATCGGACT
TAACCCTTCA ATTTAATATC TTATGTTGCT GTAGCATAAA TTTTAAGTTT AATGTCATGC TTCTCAATCC GAATATTTTC
TCAGTTAATT GCAGGCCCAT TGCTTTCTGT TGTACATATA TATGGAGTTG TGCAAGAGAT GAGGGCAACT CCTGTAAACA
CACTTAATCC GCAAAGAACA GCAATGATTG TTGCTGATTT TATCAAGGTC CATTTAATTA ACTTGTAAGT TGTTTCATTC
TTTCCAATTA CGATCCTAAT GTTTTGCTTG CACTGCAGAG TGGAAAGGTT TCCAGCCCAG CTGAGCTAAG ATATCGAGAA
GATCTTCTTT TTCCTAACCG ATTAATAGAA GAAGCAGGAA GTGTGAAAAT TGGACAACCA GTCCGCAGAG TTCTTAGCCC
ACAGCGTATC GAACAGCTGA AAGCAACTTT CTCAAAGGAG AAATTTTTGC TTAGTCGAAA AGACAACAGT GCATACATGG
TTCTTGAGCA GAGTGCAACG GGAGAAGATG CACTGAGGGG ATGGCTAGTT GCTGCCTTTG CTTCAGAAAT GGAAAGATCA
GGTGTTGGTT CAGGTGATAC AGTTCTAAAT GTAGCCTACG AGAGGATGGA GAATGTGTTC CCCATGTTTG TGGCAGAAGT
TAAGAGTAGA GGCTGGTACA CAGATCAATT TTTAGACGGA AATCGGAGTC GAATTGCATA TGCAAATCCC ATCAGCGGTA
GTGCTTTATG ACAACAATTT TCGGAGTTGA AGAGATGAGC AGATAACTTA TTTTTCACTT TGCATTGTTT GTAAAACATT
TGTTTTAATG AAATAGGCCC ATCGTGTCTT GAGTATAGAC ATGGTAAATG TATCACTGAA TCGAGTGAAT GCTTTCTGAC
GGCCAGAATT TAAATCGATA GCAACTGCTA GTTC

Locus: Os04g0517300

Loading...

Locus: Os04g0517300

Loading...