Os04t0524300-01

Locus

Os04g0524300

Description

A-type response regulator, Cytokinin signaling

RAP-DB Gene Symbol Synonym(s)

RR5, rr5, OsRR5, Rra4, OsRRA4

RAP-DB Gene Name Synonym(s)

A-TYPE RESPONSE REGULATOR 5, A-TYPE response regulator 5, Type A response regulator 5, A-type RR 4

CGSNL Gene Symbol

RR5

CGSNL Gene Name

A-TYPE RESPONSE REGULATOR 5

Oryzabase Gene Symbol Synonym(s)

rr5, OsRR5, Rra4, OsRRA4

Oryzabase Gene Name Synonym(s)

A-TYPE response regulator 5, Type A response regulator 5, A-type RR 4

Transcript Evidence

AK106426 (DDBJ)

AB249654 (DDBJ)

BR000314 (DDBJ)

Protein Evidence

Q2HWH1 (UniProt)

Literature

PMID: 16919402

PMID: 16472405

PMID: 17293362

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

April 22, 2010

Gene Ontology (GO)

Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: two-component response regulator activity (GO:0000156)

Functional domain (InterPro)

Signal transduction response regulator, receiver domain (IPR001789)

CheY-like superfamily (IPR011006)

Full-length cDNA

002-103-B09 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0524300-01)

Others

Oryzabase (8162)

Transcript

840 bp

>Os04t0524300-01 A-type response regulator, Cytokinin signaling
ACGGTCACACACAGAATTCCTAAAGCCGCCTTGCCTTTTGCTCGCGAGTAGGACTGTAGG
AGAGATATCGATCTGATGGCCACCTGCAGGAGCCGTGGCGTCGAGAGGGGCGGCGCGCCG
CACGTCCTCGCGGTGGACGACAGCTCCGTGGACCGCGCCGTCATCTCCGGCATCCTCCGG
AGCTCTCAGTTCCGCGTGACGGCTGTGGACAGCGGGAAGAGGGCATTGGAGCTGCTAGGC
TCGGAACCGAATGTGAGCATGATTATCACTGACTACTGGATGCCGGAGATGACCGGGTAT
GAACTCCTGAAGAAGGTCAAGGAGTCGTCCAGGCTGAAGGAGATCCCTGTGGTGATCATG
TCCTCGGAGAACGTCTCTACAAGGATCAACAGGTGCTTGGAGGAAGGAGCGGAGGATTTC
TTGCTGAAGCCCGTGCAGCCGTCGGACGTGTCGCGGCTGTGCAGCCGCGTCCTCCGGTGA
GCCGTGCAGGCGGCGGCCGGTCGGGTGGGCGTCGTGGGCGACTGAAGCGTCCCTGCATGC
ATATGCGGCTTCAGTGTTTTGGGGGTTGGAATTAATAGCAGCAGAAGCAGAAGCAGTAGT
AGTAGTGATTAGTGGTAGCCAAACGCACTGTGCGCTTGCAGATGTTGTGGTTAATGGGCT
GAATTTGCCTCTCCCTTTCTCTATTTTTCTCATTCCGAATGTCATGTTCTAGCTGTTCCC
TGTGTCGATCTAGAATGCAGTTTGTTCCATCGGTTTGTCCATCCCAGTTGAAAAACCTGT
TGCAACAAATGTCTAATTTTATGTTCTTAACAGTTCATCCGTTTTTCTAGTTATATTCAT

CDS

405 bp

>Os04t0524300-01 A-type response regulator, Cytokinin signaling
ATGGCCACCTGCAGGAGCCGTGGCGTCGAGAGGGGCGGCGCGCCGCACGTCCTCGCGGTG
GACGACAGCTCCGTGGACCGCGCCGTCATCTCCGGCATCCTCCGGAGCTCTCAGTTCCGC
GTGACGGCTGTGGACAGCGGGAAGAGGGCATTGGAGCTGCTAGGCTCGGAACCGAATGTG
AGCATGATTATCACTGACTACTGGATGCCGGAGATGACCGGGTATGAACTCCTGAAGAAG
GTCAAGGAGTCGTCCAGGCTGAAGGAGATCCCTGTGGTGATCATGTCCTCGGAGAACGTC
TCTACAAGGATCAACAGGTGCTTGGAGGAAGGAGCGGAGGATTTCTTGCTGAAGCCCGTG
CAGCCGTCGGACGTGTCGCGGCTGTGCAGCCGCGTCCTCCGGTGA

Protein

135 aa

>Os04t0524300-01 A-type response regulator, Cytokinin signaling
MATCRSRGVERGGAPHVLAVDDSSVDRAVISGILRSSQFRVTAVDSGKRALELLGSEPNV
SMIITDYWMPEMTGYELLKKVKESSRLKEIPVVIMSSENVSTRINRCLEEGAEDFLLKPV
QPSDVSRLCSRVLR*

5'UTR

chr04:26227217..26227291 (+ strand) : 75 bp

CDS

chr04:26227292..26227412 (+ strand) : 121 bp

chr04:26227490..26227536 (+ strand) : 47 bp

chr04:26227639..26227716 (+ strand) : 78 bp

chr04:26227828..26227898 (+ strand) : 71 bp

chr04:26227988..26228075 (+ strand) : 88 bp

3'UTR

chr04:26228076..26228435 (+ strand) : 360 bp

FASTA

>Os04t0524300-01 class=Sequence position=chr04:26227217..26228435 (+ strand)
ACGGTCACAC ACAGAATTCC TAAAGCCGCC TTGCCTTTTG CTCGCGAGTA GGACTGTAGG AGAGATATCG ATCTGATGGC
CACCTGCAGG AGCCGTGGCG TCGAGAGGGG CGGCGCGCCG CACGTCCTCG CGGTGGACGA CAGCTCCGTG GACCGCGCCG
TCATCTCCGG CATCCTCCGG AGCTCTCAGT TCCGCGGTGA GCTGCTGGCT CTCTTGCTCC TGTACCACAT ATTGTCCATC
CTCGTTCTTC TTCTTACGTG TGCATGTGTG TAGTGACGGC TGTGGACAGC GGGAAGAGGG CATTGGAGCT GCTAGGCTCG
GTGAGTCTCC GGCATCCTCT GCCTTTTTGC TGTTGGTTAC GCAAATGTGG AGGTGTGTTT TGCCTGCGAG GCCGTAAACG
TTTTTTTTTC TTTGGCTCGC AGGAACCGAA TGTGAGCATG ATTATCACTG ACTACTGGAT GCCGGAGATG ACCGGGTATG
AACTCCTGAA GAAGGTCAAG GTAATCCGGT GATATCACCA CCGTTATTTG GGCCAACTTC CATAGTACTC CTCGTGCATA
TTACTACTCA CCTTTTCTGA TTTGACAATA GAAAATGGCA TATCTTTGCA GGAGTCGTCC AGGCTGAAGG AGATCCCTGT
GGTGATCATG TCCTCGGAGA ACGTCTCTAC AAGGATCAAC AGGTTTGTGT GCACAGTATC GGTGCCCATA TCTGCCCAAA
TACTATCAAG ATATACTCAT CTTCTTGACA CGTTTTTGGT TAATTTGCCA GGTGCTTGGA GGAAGGAGCG GAGGATTTCT
TGCTGAAGCC CGTGCAGCCG TCGGACGTGT CGCGGCTGTG CAGCCGCGTC CTCCGGTGAG CCGTGCAGGC GGCGGCCGGT
CGGGTGGGCG TCGTGGGCGA CTGAAGCGTC CCTGCATGCA TATGCGGCTT CAGTGTTTTG GGGGTTGGAA TTAATAGCAG
CAGAAGCAGA AGCAGTAGTA GTAGTGATTA GTGGTAGCCA AACGCACTGT GCGCTTGCAG ATGTTGTGGT TAATGGGCTG
AATTTGCCTC TCCCTTTCTC TATTTTTCTC ATTCCGAATG TCATGTTCTA GCTGTTCCCT GTGTCGATCT AGAATGCAGT
TTGTTCCATC GGTTTGTCCA TCCCAGTTGA AAAACCTGTT GCAACAAATG TCTAATTTTA TGTTCTTAAC AGTTCATCCG
TTTTTCTAGT TATATTCAT