Os04t0530500-01

Locus

Os04g0530500

Description

Zinc finger, RING/FYVE/PHD-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RDCP1

CGSNL Gene Name

RING DOMAIN-CONTAINING PROTEIN 1

Oryzabase Gene Symbol Synonym(s)

OsRDCP1

Oryzabase Gene Name Synonym(s)

RING domain-containing protein 1, RING domain containing protein 1

Transcript Evidence

AK070732 (DDBJ, Best hit)

Protein Evidence

NP_001152715.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, RING-type (IPR001841)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, RING-type, conserved site (IPR017907)

Zinc finger, C3HC4 RING-type (IPR018957)

Full-length cDNA

J023063I18 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0530500-01)

Others

Oryzabase (9449)

Transcript

1219 bp

>Os04t0530500-01 Zinc finger, RING/FYVE/PHD-type domain containing protein.
CCCGTCTCGCCTCCTCCGCAAGTGACGTCGACGCCTCATCTCCCCTCCCTCTTTTTCCCC
GCAGCGATACGGCATTCGTGACCTCCCGATTGTTGCCAACCCCCCTCGCCTTCCGATTGC
TGCCACCCCCGCGCCTCGCCGCTTGCCCGTCTCCTGTTCGTCCCTCGGGAGCGGGAGGCT
AGGGCCGACAGCAGCGTTCGCGCCGGCGCGGGATTGGGTTCTTTGTTCTTGTCAGTGCTG
TGTTTGCTCGCAAGGGTCATCGTGAGAATGGACCAGATTTACATGGCTGCTGTCAATAAC
AAGACTTCATTGCCTGATGATGAGCCAATGAAGAAAATTAGTGGAGATATGCCTGTGACT
GCTGGAAACGCTTGCTTTGACTGCAACATTTGCCTTGATTTTGCAGCAGAGCCGGTGGTT
ACTCTTTGTGGTCATCTCTACTGCTGGCCTTGCATCTATGAGTGGCTATGTCCAGGGGTT
GGATCGACTGCCAGTAACAACAGCAGTTTGGCAAGGCGACAGTGCCCTGTGTGTAAGGCT
ACACTCTCCCCAGACATGCTGGTGCCATTGTATGGTCGTGGGGGGAGTCTGAAGAAATCA
CTGAATGGTGTGCCCATTCCACGACGACCAACCGTGCAGCGGGAGGCGGTTGAGCATCAA
AACACACACAATAACATCGATGATCGGCACCATGAGAACATGGAACCCAGCCCTCCACCA
CAACCGCTGCGGCATTCGAGCCATCATTCCAGTGCAACTGAATTTGATTTTATTTACCCG
CCATCACCAATTGGGCGTGGCTTGATCCACTCGACGGCTGGTGGTGTGCTTGGGGGGATG
GCAGTGGCGGTGCTACCATGGGCATTCCGTGGCCAGGTGCCACCGAGCATGTTCATGAGT
CCCCACTATGTCACGGCACACAATATGAGCTCTAGAGCGAGGAGACATCAGATGGAAGTT
GAGAGGTCACTGCATCAGATCTGGTTCTTCCTCTTCGTTTTTGTGGTGCTGTGCCTGCTC
TTGTTCTGAAGCAAGATGGTGGTGTATTCCTTTTGTAAATACGGGAAGGCAAGACACTAA
TGGGTGGATGCATATGGTAAAAGAGGGTGGTTAACACTGTTGGTCTGTATCGATAAGCAT
GTGCCTAAAGCATGCTGATATAGAGATGTAATGTGACAAGACTTAAGGTGAAATGCACAT
TTCATTCTTCTCTTGTCCT

CDS

762 bp

>Os04t0530500-01 Zinc finger, RING/FYVE/PHD-type domain containing protein.
ATGGACCAGATTTACATGGCTGCTGTCAATAACAAGACTTCATTGCCTGATGATGAGCCA
ATGAAGAAAATTAGTGGAGATATGCCTGTGACTGCTGGAAACGCTTGCTTTGACTGCAAC
ATTTGCCTTGATTTTGCAGCAGAGCCGGTGGTTACTCTTTGTGGTCATCTCTACTGCTGG
CCTTGCATCTATGAGTGGCTATGTCCAGGGGTTGGATCGACTGCCAGTAACAACAGCAGT
TTGGCAAGGCGACAGTGCCCTGTGTGTAAGGCTACACTCTCCCCAGACATGCTGGTGCCA
TTGTATGGTCGTGGGGGGAGTCTGAAGAAATCACTGAATGGTGTGCCCATTCCACGACGA
CCAACCGTGCAGCGGGAGGCGGTTGAGCATCAAAACACACACAATAACATCGATGATCGG
CACCATGAGAACATGGAACCCAGCCCTCCACCACAACCGCTGCGGCATTCGAGCCATCAT
TCCAGTGCAACTGAATTTGATTTTATTTACCCGCCATCACCAATTGGGCGTGGCTTGATC
CACTCGACGGCTGGTGGTGTGCTTGGGGGGATGGCAGTGGCGGTGCTACCATGGGCATTC
CGTGGCCAGGTGCCACCGAGCATGTTCATGAGTCCCCACTATGTCACGGCACACAATATG
AGCTCTAGAGCGAGGAGACATCAGATGGAAGTTGAGAGGTCACTGCATCAGATCTGGTTC
TTCCTCTTCGTTTTTGTGGTGCTGTGCCTGCTCTTGTTCTGA

Protein

254 aa

>Os04t0530500-01 Zinc finger, RING/FYVE/PHD-type domain containing protein.
MDQIYMAAVNNKTSLPDDEPMKKISGDMPVTAGNACFDCNICLDFAAEPVVTLCGHLYCW
PCIYEWLCPGVGSTASNNSSLARRQCPVCKATLSPDMLVPLYGRGGSLKKSLNGVPIPRR
PTVQREAVEHQNTHNNIDDRHHENMEPSPPPQPLRHSSHHSSATEFDFIYPPSPIGRGLI
HSTAGGVLGGMAVAVLPWAFRGQVPPSMFMSPHYVTAHNMSSRARRHQMEVERSLHQIWF
FLFVFVVLCLLLF*

5'UTR

chr04:26535727..26535961 (- strand) : 235 bp

chr04:26533601..26533632 (- strand) : 32 bp

CDS

chr04:26532839..26533600 (- strand) : 762 bp

3'UTR

chr04:26532649..26532838 (- strand) : 190 bp

FASTA

>Os04t0530500-01 class=Sequence position=chr04:26532649..26535961 (- strand)
CCCGTCTCGC CTCCTCCGCA AGTGACGTCG ACGCCTCATC TCCCCTCCCT CTTTTTCCCC GCAGCGATAC GGCATTCGTG
ACCTCCCGAT TGTTGCCAAC CCCCCTCGCC TTCCGATTGC TGCCACCCCC GCGCCTCGCC GCTTGCCCGT CTCCTGTTCG
TCCCTCGGGA GCGGGAGGCT AGGGCCGACA GCAGCGTTCG CGCCGGCGCG GGATTGGGTT CTTTGTTCTT GTCAGGTCAG
CGGGATGAAA TCTCTTGTTT CCTTTTGATG TTTTTTTTTG TTTTTGCCCG AAAGATTTTG CGTTGTCTGG TCGATTGGAG
GACCGGTGTG TGTCATGGGG GTTGATCTCG GTTGGATTCT TAGGTTGCTG CCTGCCCTTG GGTTAGCTCC GAAAGGTTCT
GATGCTTTGC TGCTGCTGCT CCTCCTGGCT TGTGCTGTTC GTGCTTGGGG TTGTGATGCC TTTGTCCTTC TCGAGGAACA
AGGGAAGATC GTTGTTAGCT CTGTCGGTGG TCTCCTTTCC TTTCCTCGGT TTGGCCAATT GTGTGTTGAT GCGCCTGCCG
CACTAGGAAA TCGACGGTGC TAAAATCGTT TTTCTACCCA ATGTCCAACC GAGAAATTGT TTATGTTTAG ATTTAGTGCA
GTATCAATTT GAACCGCACT AGGGAATCGA CGGTGCTAAA ATCGTTTTTT TACCCAATAT CCAACTTCCA AACTTCTAAT
TTCGTTTGTG TATTGACGAA TGCGTGCCCT GTGTTAGACA TGAGCAGACA GCATTTGGAG GATTTACTAC CATACACAAA
TCTGAACAAT TTTAACAAAA TGTGTTCGCA CTCCAAAACA TGATTTATGA TGTAATACAC TGTTTCTCCA CAACATTGAC
TTCTTGTGTG AATTCTTAAT GGTGATAGCG GTGGATTTGT TGTGTGAATT CTTAATGGTG ATAGCGGTTG ATGCTGCTGA
GCTTAGCAGA TCCGTGTGCT TGATTATTGT TTCGTTTCGT AGTCTCACAT TCAGGATCAG TTATTTTGTT TCTTAAGGCT
ACTCTTATTA GCCGTCTATC TAAATTTTAA CACTAGGAAT ATTGATGTGC TCCCACATTT ATCTAAAATA CTCAATGTAA
CAAAACAACG TGTCTGAATT TGCGATAGCC TGAGCTTAAG CTCACCAGTT AATAATATTA CACATGGGAT GAGAGCAATC
AAGAAATTTC GAAGATGCTG GTGGACAAAT AATTCAGTGT TCCCTGATTC TAATACAGTA TATTGCCATT ATCTCTTGGT
TATAATTATT TTAGTCGGTC ACTAGATATG TGAAGTAGTG GTCTTTTCGG TGTATTTGAT TTAATTCAAT ATGCCAAATG
ATGTAGCTAA TCCATCATTG TTGTGTCCAC ATCACTTTCC ACACCTTGTT TTTTTTTTCA ATAATTCACT TGTCGATGGA
CCTTATCAAC CACATAAAGT TCACTATGTC ATGGAAGCAT TTATTGGAGA TTGGGATGGG ATGCCTCTCA GGCTTAGTCA
ACTCTGCTGG TTTATTCGTC CATAGCTGCT TACCTGAATA TTTCTATAGA ATCAATTAGA AGAGAGGCAG TATTAATCTA
GTCAGGACCT GCCAGGCTGC CATCCTTGTC TAAGCCGCCG TTTGTAAACT GTGGGTGCAT ATTAAATGCT AACTGTTTTG
TACTATGCCT TTTCTTCCCA AGGCATAGTA ACTTTAAGTT GGCAATGATG GTTAATCTTA ATAGTATTGA CTTTGCACAC
ATAGGACATA AGCTGTTTCA TTTCCTTGCT GACAAAAGTT CCCCATTTAT CCTGATAGAT AATACTTGTA GCGTAGGGAT
AAGAATGTCA TTTGTGATAA AAAATAAAGG GCAGTGTATC TAGTTCCTAT TGAAAAAATT GGATAATCCA TTCCATGACT
GCTGACTCAG CCTGCTAGGA AAGATGATGG ATTCTTCCTT GATGTATCAA TTGATTACTA ACCAGGATAA TATTAAGTAG
TTTTTTTCTG GCATATAGAC ACGGAGTTTT GGAGCTTTAC CTAACATCTG CACCACTCTT CAGACTTGTT AAATGTATTT
GGATAGACTT CGCTGGACAG GATGATGTGG TGTGGGCCAA AAAGCTGCAT TTTACCTGGA CCCGCTTAGT TTCATATAAA
TCTGTTGGTA CCATGTGGCT TGCGTTGTTC CTTCCATTCT CATTTCTGGT GTGTTTTAAG TTTTTATTTC TGTACAATGA
TTAGTAAAGT GGGCCCCACT CAGTGATGCT TTACTTAACT ACATGTCATA TGCATTCCTA GTGACATATT TTTGTTTGTT
GAACTGCAGT GCTGTGTTTG CTCGCAAGGG TCATCGTGAG AATGGACCAG ATTTACATGG CTGCTGTCAA TAACAAGACT
TCATTGCCTG ATGATGAGCC AATGAAGAAA ATTAGTGGAG ATATGCCTGT GACTGCTGGA AACGCTTGCT TTGACTGCAA
CATTTGCCTT GATTTTGCAG CAGAGCCGGT GGTTACTCTT TGTGGTCATC TCTACTGCTG GCCTTGCATC TATGAGTGGC
TATGTCCAGG GGTTGGATCG ACTGCCAGTA ACAACAGCAG TTTGGCAAGG CGACAGTGCC CTGTGTGTAA GGCTACACTC
TCCCCAGACA TGCTGGTGCC ATTGTATGGT CGTGGGGGGA GTCTGAAGAA ATCACTGAAT GGTGTGCCCA TTCCACGACG
ACCAACCGTG CAGCGGGAGG CGGTTGAGCA TCAAAACACA CACAATAACA TCGATGATCG GCACCATGAG AACATGGAAC
CCAGCCCTCC ACCACAACCG CTGCGGCATT CGAGCCATCA TTCCAGTGCA ACTGAATTTG ATTTTATTTA CCCGCCATCA
CCAATTGGGC GTGGCTTGAT CCACTCGACG GCTGGTGGTG TGCTTGGGGG GATGGCAGTG GCGGTGCTAC CATGGGCATT
CCGTGGCCAG GTGCCACCGA GCATGTTCAT GAGTCCCCAC TATGTCACGG CACACAATAT GAGCTCTAGA GCGAGGAGAC
ATCAGATGGA AGTTGAGAGG TCACTGCATC AGATCTGGTT CTTCCTCTTC GTTTTTGTGG TGCTGTGCCT GCTCTTGTTC
TGAAGCAAGA TGGTGGTGTA TTCCTTTTGT AAATACGGGA AGGCAAGACA CTAATGGGTG GATGCATATG GTAAAAGAGG
GTGGTTAACA CTGTTGGTCT GTATCGATAA GCATGTGCCT AAAGCATGCT GATATAGAGA TGTAATGTGA CAAGACTTAA
GGTGAAATGC ACATTTCATT CTTCTCTTGT CCT