Os04t0530500-02

Locus

Os04g0530500

Description

Zinc finger, RING/FYVE/PHD-type domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RDCP1

CGSNL Gene Name

RING DOMAIN-CONTAINING PROTEIN 1

Oryzabase Gene Symbol Synonym(s)

OsRDCP1

Oryzabase Gene Name Synonym(s)

RING domain-containing protein 1, RING domain containing protein 1

Transcript Evidence

AK104359 (DDBJ, Best hit)

Protein Evidence

NP_001152715.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Zinc finger, RING-type (IPR001841)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, RING-type, conserved site (IPR017907)

Zinc finger, C3HC4 RING-type (IPR018957)

Full-length cDNA

001-035-B09 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0530500-02)

Others

Oryzabase (9449)

Transcript

1153 bp

>Os04t0530500-02 Zinc finger, RING/FYVE/PHD-type domain containing protein.
GCAGCGATACGGCATTCGTGACCTCCCGATTGTTGCCAACCCCCCTCGCCTTCCGATTGC
TGCCACCCCCGCGCCTCGCCGCTTGCCCGTCTCCTGTTCGTCCCTCGGGAGCGGGAGGCT
AGGGCCGACAGCAGCGTTCGCGCCGGCGCGGGATTGGGTTCTTTGTTCTTGTCAGTGCTG
TGTTTGCTCGCAAGGGTCATCGTGAGAATGGACCAGATTTACATGGCTGCTGTCAATAAC
AAGACTTCATTGCCTGATGATGAGCCAATGAAGAAAATTAGTGGAGATATGCCTGTGACT
GCTGGAAACGCTTGCTTTGACTGCAACATTTGCCTTGATTTTGCAGCAGAGCCGGTGGTT
ACTCTTTGTGGTCATCTCTACTGCTGGCCTTGCATCTATGAGTGGCTATGTCCAGGGGTT
GGATCGACTGCCAGTAACAACAGCAGTTTGGCAAGGCGACAGTGCCCTGTGTGTAAGGCT
ACACTCTCCCCAGACATGCTGGTGCCATTGTATGGTCGTGGGGGGAGTCTGAAGAAATCA
CTGAATGGTGTGCCCATTCCACGACGACCAACCGTGCAGCGGGAGGCGGTTGAGCATCAA
AACACACACAATAACATCGATGATCGGCACCATGAGAACATGGAACCCAGCCCTCCACCA
CAACCGCTGCGGCATTCGAGCCATCATTCCAGTGCAACTGAATTTGATTTTATTTACCCG
CCATCACCAATTGGGCGTGGCTTGATCCACTCGACGGCTGGTGGTGTGCTTGGGGGGATG
GCAGTGGCGGTGCTACCATGGGCATTCCGTGGCCAGGTGCCACCGAGCATGTTCATGAGT
CCCCACTATGTCACGGCACACAATATGAGCTCTAGAGCGAGGAGACATCAGATGGAAGTT
GAGAGGTCACTGCATCAGATCTGGTTCTTCCTCTTCGTTTTTGTGGTGCTGTGCCTGCTC
TTGTTCTGAAGCAAGATGGTGGTGTATTCCTTTTGTAAATACGGGAAGGCAAGACACTAA
TGGGTGGATGCATATGGTAAAAGAGGGTGGTTAACACTGTTGGTCTGTATCGATAAGCAT
GTGCCTAAAGCATGCTGATATAGAGATGTAATGTGACAAGACTTAAGGTGAAATGCACAT
TTCATTCTTCTCT

CDS

762 bp

>Os04t0530500-02 Zinc finger, RING/FYVE/PHD-type domain containing protein.
ATGGACCAGATTTACATGGCTGCTGTCAATAACAAGACTTCATTGCCTGATGATGAGCCA
ATGAAGAAAATTAGTGGAGATATGCCTGTGACTGCTGGAAACGCTTGCTTTGACTGCAAC
ATTTGCCTTGATTTTGCAGCAGAGCCGGTGGTTACTCTTTGTGGTCATCTCTACTGCTGG
CCTTGCATCTATGAGTGGCTATGTCCAGGGGTTGGATCGACTGCCAGTAACAACAGCAGT
TTGGCAAGGCGACAGTGCCCTGTGTGTAAGGCTACACTCTCCCCAGACATGCTGGTGCCA
TTGTATGGTCGTGGGGGGAGTCTGAAGAAATCACTGAATGGTGTGCCCATTCCACGACGA
CCAACCGTGCAGCGGGAGGCGGTTGAGCATCAAAACACACACAATAACATCGATGATCGG
CACCATGAGAACATGGAACCCAGCCCTCCACCACAACCGCTGCGGCATTCGAGCCATCAT
TCCAGTGCAACTGAATTTGATTTTATTTACCCGCCATCACCAATTGGGCGTGGCTTGATC
CACTCGACGGCTGGTGGTGTGCTTGGGGGGATGGCAGTGGCGGTGCTACCATGGGCATTC
CGTGGCCAGGTGCCACCGAGCATGTTCATGAGTCCCCACTATGTCACGGCACACAATATG
AGCTCTAGAGCGAGGAGACATCAGATGGAAGTTGAGAGGTCACTGCATCAGATCTGGTTC
TTCCTCTTCGTTTTTGTGGTGCTGTGCCTGCTCTTGTTCTGA

Protein

254 aa

>Os04t0530500-02 Zinc finger, RING/FYVE/PHD-type domain containing protein.
MDQIYMAAVNNKTSLPDDEPMKKISGDMPVTAGNACFDCNICLDFAAEPVVTLCGHLYCW
PCIYEWLCPGVGSTASNNSSLARRQCPVCKATLSPDMLVPLYGRGGSLKKSLNGVPIPRR
PTVQREAVEHQNTHNNIDDRHHENMEPSPPPQPLRHSSHHSSATEFDFIYPPSPIGRGLI
HSTAGGVLGGMAVAVLPWAFRGQVPPSMFMSPHYVTAHNMSSRARRHQMEVERSLHQIWF
FLFVFVVLCLLLF*

5'UTR

chr04:26535727..26535901 (- strand) : 175 bp

chr04:26533601..26533632 (- strand) : 32 bp

CDS

chr04:26532839..26533600 (- strand) : 762 bp

3'UTR

chr04:26532655..26532838 (- strand) : 184 bp

FASTA

>Os04t0530500-02 class=Sequence position=chr04:26532655..26535901 (- strand)
GCAGCGATAC GGCATTCGTG ACCTCCCGAT TGTTGCCAAC CCCCCTCGCC TTCCGATTGC TGCCACCCCC GCGCCTCGCC
GCTTGCCCGT CTCCTGTTCG TCCCTCGGGA GCGGGAGGCT AGGGCCGACA GCAGCGTTCG CGCCGGCGCG GGATTGGGTT
CTTTGTTCTT GTCAGGTCAG CGGGATGAAA TCTCTTGTTT CCTTTTGATG TTTTTTTTTG TTTTTGCCCG AAAGATTTTG
CGTTGTCTGG TCGATTGGAG GACCGGTGTG TGTCATGGGG GTTGATCTCG GTTGGATTCT TAGGTTGCTG CCTGCCCTTG
GGTTAGCTCC GAAAGGTTCT GATGCTTTGC TGCTGCTGCT CCTCCTGGCT TGTGCTGTTC GTGCTTGGGG TTGTGATGCC
TTTGTCCTTC TCGAGGAACA AGGGAAGATC GTTGTTAGCT CTGTCGGTGG TCTCCTTTCC TTTCCTCGGT TTGGCCAATT
GTGTGTTGAT GCGCCTGCCG CACTAGGAAA TCGACGGTGC TAAAATCGTT TTTCTACCCA ATGTCCAACC GAGAAATTGT
TTATGTTTAG ATTTAGTGCA GTATCAATTT GAACCGCACT AGGGAATCGA CGGTGCTAAA ATCGTTTTTT TACCCAATAT
CCAACTTCCA AACTTCTAAT TTCGTTTGTG TATTGACGAA TGCGTGCCCT GTGTTAGACA TGAGCAGACA GCATTTGGAG
GATTTACTAC CATACACAAA TCTGAACAAT TTTAACAAAA TGTGTTCGCA CTCCAAAACA TGATTTATGA TGTAATACAC
TGTTTCTCCA CAACATTGAC TTCTTGTGTG AATTCTTAAT GGTGATAGCG GTGGATTTGT TGTGTGAATT CTTAATGGTG
ATAGCGGTTG ATGCTGCTGA GCTTAGCAGA TCCGTGTGCT TGATTATTGT TTCGTTTCGT AGTCTCACAT TCAGGATCAG
TTATTTTGTT TCTTAAGGCT ACTCTTATTA GCCGTCTATC TAAATTTTAA CACTAGGAAT ATTGATGTGC TCCCACATTT
ATCTAAAATA CTCAATGTAA CAAAACAACG TGTCTGAATT TGCGATAGCC TGAGCTTAAG CTCACCAGTT AATAATATTA
CACATGGGAT GAGAGCAATC AAGAAATTTC GAAGATGCTG GTGGACAAAT AATTCAGTGT TCCCTGATTC TAATACAGTA
TATTGCCATT ATCTCTTGGT TATAATTATT TTAGTCGGTC ACTAGATATG TGAAGTAGTG GTCTTTTCGG TGTATTTGAT
TTAATTCAAT ATGCCAAATG ATGTAGCTAA TCCATCATTG TTGTGTCCAC ATCACTTTCC ACACCTTGTT TTTTTTTTCA
ATAATTCACT TGTCGATGGA CCTTATCAAC CACATAAAGT TCACTATGTC ATGGAAGCAT TTATTGGAGA TTGGGATGGG
ATGCCTCTCA GGCTTAGTCA ACTCTGCTGG TTTATTCGTC CATAGCTGCT TACCTGAATA TTTCTATAGA ATCAATTAGA
AGAGAGGCAG TATTAATCTA GTCAGGACCT GCCAGGCTGC CATCCTTGTC TAAGCCGCCG TTTGTAAACT GTGGGTGCAT
ATTAAATGCT AACTGTTTTG TACTATGCCT TTTCTTCCCA AGGCATAGTA ACTTTAAGTT GGCAATGATG GTTAATCTTA
ATAGTATTGA CTTTGCACAC ATAGGACATA AGCTGTTTCA TTTCCTTGCT GACAAAAGTT CCCCATTTAT CCTGATAGAT
AATACTTGTA GCGTAGGGAT AAGAATGTCA TTTGTGATAA AAAATAAAGG GCAGTGTATC TAGTTCCTAT TGAAAAAATT
GGATAATCCA TTCCATGACT GCTGACTCAG CCTGCTAGGA AAGATGATGG ATTCTTCCTT GATGTATCAA TTGATTACTA
ACCAGGATAA TATTAAGTAG TTTTTTTCTG GCATATAGAC ACGGAGTTTT GGAGCTTTAC CTAACATCTG CACCACTCTT
CAGACTTGTT AAATGTATTT GGATAGACTT CGCTGGACAG GATGATGTGG TGTGGGCCAA AAAGCTGCAT TTTACCTGGA
CCCGCTTAGT TTCATATAAA TCTGTTGGTA CCATGTGGCT TGCGTTGTTC CTTCCATTCT CATTTCTGGT GTGTTTTAAG
TTTTTATTTC TGTACAATGA TTAGTAAAGT GGGCCCCACT CAGTGATGCT TTACTTAACT ACATGTCATA TGCATTCCTA
GTGACATATT TTTGTTTGTT GAACTGCAGT GCTGTGTTTG CTCGCAAGGG TCATCGTGAG AATGGACCAG ATTTACATGG
CTGCTGTCAA TAACAAGACT TCATTGCCTG ATGATGAGCC AATGAAGAAA ATTAGTGGAG ATATGCCTGT GACTGCTGGA
AACGCTTGCT TTGACTGCAA CATTTGCCTT GATTTTGCAG CAGAGCCGGT GGTTACTCTT TGTGGTCATC TCTACTGCTG
GCCTTGCATC TATGAGTGGC TATGTCCAGG GGTTGGATCG ACTGCCAGTA ACAACAGCAG TTTGGCAAGG CGACAGTGCC
CTGTGTGTAA GGCTACACTC TCCCCAGACA TGCTGGTGCC ATTGTATGGT CGTGGGGGGA GTCTGAAGAA ATCACTGAAT
GGTGTGCCCA TTCCACGACG ACCAACCGTG CAGCGGGAGG CGGTTGAGCA TCAAAACACA CACAATAACA TCGATGATCG
GCACCATGAG AACATGGAAC CCAGCCCTCC ACCACAACCG CTGCGGCATT CGAGCCATCA TTCCAGTGCA ACTGAATTTG
ATTTTATTTA CCCGCCATCA CCAATTGGGC GTGGCTTGAT CCACTCGACG GCTGGTGGTG TGCTTGGGGG GATGGCAGTG
GCGGTGCTAC CATGGGCATT CCGTGGCCAG GTGCCACCGA GCATGTTCAT GAGTCCCCAC TATGTCACGG CACACAATAT
GAGCTCTAGA GCGAGGAGAC ATCAGATGGA AGTTGAGAGG TCACTGCATC AGATCTGGTT CTTCCTCTTC GTTTTTGTGG
TGCTGTGCCT GCTCTTGTTC TGAAGCAAGA TGGTGGTGTA TTCCTTTTGT AAATACGGGA AGGCAAGACA CTAATGGGTG
GATGCATATG GTAAAAGAGG GTGGTTAACA CTGTTGGTCT GTATCGATAA GCATGTGCCT AAAGCATGCT GATATAGAGA
TGTAATGTGA CAAGACTTAA GGTGAAATGC ACATTTCATT CTTCTCT