Os04t0540200-01

Locus

Os04g0540200

Description

BBX transcription factor, Regulation of heading date

RAP-DB Gene Symbol Synonym(s)

OsRIP1

RAP-DB Gene Name Synonym(s)

OsRE1-INTERACTING PROTEIN 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsBBX13, BBX13, OsRIP1, RIP1

Oryzabase Gene Name Synonym(s)

B-box-containing protein 13, OsRE1-INTERACTING PROTEIN 1, RE1-INTERACTING PROTEIN 1

Transcript Evidence

AK061333

Protein Evidence

Q7XR92

Literature

PMID: 32757315

Note

Manual Curation

August 7, 2020

Gene Ontology (GO)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

B-box-type zinc finger (IPR000315)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

006-303-A11 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0540200-01)

RiceXPro (AK061333)

Others

Oryzabase (11644)

KEGG (Os04t0540200-01)

Transcript

1220 bp

>Os04t0540200-01 BBX transcription factor, Regulation of heading date
ACCACTCGTCCACTCCTAATAACCTACCACTCTACTTCTCCTTGCAACATCGTCGTTAGT
CCTCTAACCCAAGGCATTGACCTGAGCTTGTTGTGCGCTTCTGCCTTATCTGCATCCCCT
CCCGGCCGAGACGCGACCATCTTTCTTTCCCGCTTCGTTAGCTGTCTCTGCCGATCGATC
GGACTGGACGGGGAGACATGAAGGTGCAGTGCGACGTGTGCGCGGCCGAGGCCGCCTCGG
TCTTCTGCTGCGCCGACGAGGCCGCGCTGTGCGACGCGTGCGACCGCCGCGTCCACAGCG
CGAACAAGCTCGCCGGGAAGCACCGCCGATTCTCCCTCCTCCAACCGTTGGCGTCGTCGT
CGTCCGCCCAGAAGCCACCGCTCTGCGACATCTGTCAGGAGAAGAGGGGGTTCTTGTTCT
GCAAGGAGGACAGGGCGATCCTGTGCCGGGAGTGCGACGTCACGGTGCACACCACGAGCG
AGCTGACGAGGCGGCACGGCCGGTTCCTCCTCACCGGCGTGCGCCTCTCGTCGGCGCCGA
TGGACTCCCCCGCGCCGTCGGAGGAAGAGGAGGAGGAAGCAGGGGAGGACTACAGCTGCA
GCCCCAGCAGCGTCGCCGGCACCGCCGCGGGGAGCGCGAGCGACGGGAGCAGCATCTCCG
AGTACCTCACCAAGACGCTGCCCGGTTGGCACGTCGAGGACTTCCTCGTCGACGAGGCCA
CCGCCGCCTCCTCCTCCTCAGACGGGCTATTTCAGGGTGGGCTGCTGGCTCAGATCGGTG
GGGTGCCGGACGGTTACGCGGCGTGGGCCGGCCGGGAGCAGCTGCACAGTGGCGTCGCTG
TCGCCGCCGACGAGCGGGCCAGCCGCGAGCGGTGGGTGCCGCAGATGAACGCGGAGTGGG
GCGCCGGCAGCAAGCGACCCAGGGCGTCGCCTCCCTGCTTGTACTGGTGAAAAAAAAACG
TGCGCTTATCAGCCACAGCCAGTACGAAATGTACGATGCTTGTGTACCAGTGTACTGAGG
TAGTAGCGTTAGAAGATTAGGAATTTAGTAGTGGATGTTGATTTTGAGCTTAACGCGTGT
CTTGGATGAATCCCTGACTCCTGAATGTTTGGGGAATTAATGTGAGTGGTAGTGTCCTCT
TTGGGCGGCAAAGAATTATACGCCCCTTGCGAACATGTCGAACTGTACGGTCTGCCATTT
AATCTGCACGTTCACCCCTC

CDS

753 bp

>Os04t0540200-01 BBX transcription factor, Regulation of heading date
ATGAAGGTGCAGTGCGACGTGTGCGCGGCCGAGGCCGCCTCGGTCTTCTGCTGCGCCGAC
GAGGCCGCGCTGTGCGACGCGTGCGACCGCCGCGTCCACAGCGCGAACAAGCTCGCCGGG
AAGCACCGCCGATTCTCCCTCCTCCAACCGTTGGCGTCGTCGTCGTCCGCCCAGAAGCCA
CCGCTCTGCGACATCTGTCAGGAGAAGAGGGGGTTCTTGTTCTGCAAGGAGGACAGGGCG
ATCCTGTGCCGGGAGTGCGACGTCACGGTGCACACCACGAGCGAGCTGACGAGGCGGCAC
GGCCGGTTCCTCCTCACCGGCGTGCGCCTCTCGTCGGCGCCGATGGACTCCCCCGCGCCG
TCGGAGGAAGAGGAGGAGGAAGCAGGGGAGGACTACAGCTGCAGCCCCAGCAGCGTCGCC
GGCACCGCCGCGGGGAGCGCGAGCGACGGGAGCAGCATCTCCGAGTACCTCACCAAGACG
CTGCCCGGTTGGCACGTCGAGGACTTCCTCGTCGACGAGGCCACCGCCGCCTCCTCCTCC
TCAGACGGGCTATTTCAGGGTGGGCTGCTGGCTCAGATCGGTGGGGTGCCGGACGGTTAC
GCGGCGTGGGCCGGCCGGGAGCAGCTGCACAGTGGCGTCGCTGTCGCCGCCGACGAGCGG
GCCAGCCGCGAGCGGTGGGTGCCGCAGATGAACGCGGAGTGGGGCGCCGGCAGCAAGCGA
CCCAGGGCGTCGCCTCCCTGCTTGTACTGGTGA

Protein

251 aa

>Os04t0540200-01 BBX transcription factor, Regulation of heading date
MKVQCDVCAAEAASVFCCADEAALCDACDRRVHSANKLAGKHRRFSLLQPLASSSSAQKP
PLCDICQEKRGFLFCKEDRAILCRECDVTVHTTSELTRRHGRFLLTGVRLSSAPMDSPAP
SEEEEEEAGEDYSCSPSSVAGTAAGSASDGSSISEYLTKTLPGWHVEDFLVDEATAASSS
SDGLFQGGLLAQIGGVPDGYAAWAGREQLHSGVAVAADERASRERWVPQMNAEWGAGSKR
PRASPPCLYW*

5'UTR

chr04:27027267..27027463 (+ strand) : 197 bp

CDS

chr04:27027464..27027664 (+ strand) : 201 bp

chr04:27027758..27028114 (+ strand) : 357 bp

chr04:27028957..27029151 (+ strand) : 195 bp

3'UTR

chr04:27029152..27029421 (+ strand) : 270 bp

FASTA

>Os04t0540200-01 class=Sequence position=chr04:27027267..27029421 (+ strand)
ACCACTCGTC CACTCCTAAT AACCTACCAC TCTACTTCTC CTTGCAACAT CGTCGTTAGT CCTCTAACCC AAGGCATTGA
CCTGAGCTTG TTGTGCGCTT CTGCCTTATC TGCATCCCCT CCCGGCCGAG ACGCGACCAT CTTTCTTTCC CGCTTCGTTA
GCTGTCTCTG CCGATCGATC GGACTGGACG GGGAGACATG AAGGTGCAGT GCGACGTGTG CGCGGCCGAG GCCGCCTCGG
TCTTCTGCTG CGCCGACGAG GCCGCGCTGT GCGACGCGTG CGACCGCCGC GTCCACAGCG CGAACAAGCT CGCCGGGAAG
CACCGCCGAT TCTCCCTCCT CCAACCGTTG GCGTCGTCGT CGTCCGCCCA GAAGCCACCG CTCTGCGACA TCTGTCAGGT
ATGCACGCGG CGAGAGGCTG CTGCTCTTTT TCCTCGGGTT GCTTCTGTTG CTTGCTGCAA CTCTGAAGCG TGTGGACTCT
CGTCACTTCA GGAGAAGAGG GGGTTCTTGT TCTGCAAGGA GGACAGGGCG ATCCTGTGCC GGGAGTGCGA CGTCACGGTG
CACACCACGA GCGAGCTGAC GAGGCGGCAC GGCCGGTTCC TCCTCACCGG CGTGCGCCTC TCGTCGGCGC CGATGGACTC
CCCCGCGCCG TCGGAGGAAG AGGAGGAGGA AGCAGGGGAG GACTACAGCT GCAGCCCCAG CAGCGTCGCC GGCACCGCCG
CGGGGAGCGC GAGCGACGGG AGCAGCATCT CCGAGTACCT CACCAAGACG CTGCCCGGTT GGCACGTCGA GGACTTCCTC
GTCGACGAGG CCACCGCCGC CTCCTCCTCC TCAGACGGGC TATTTCAGGT CAGTTCATCC ACTGTTAACG ATCCAAACTT
TCCATGGCAA CGAAAACCTG AATACGTATT CAGTCCGGTT CATGCATGAA ACCCTGAAAA ACCAATCCAC ACACGTTCTT
GTGAGCACCA TGAACGAAGC ACAGGCAAAG CACGGCGCGC CAAACTCTGT TCAGGCCCTG CCGGCCGTCG TGGGCACATA
AGCCAATCTG TTCACAATAT CGTGAGCGGA CAAATTTTAC CATGCAGGTA GTTTGTAGTC ATGCTCACAC AGCTAGCAAT
AACAAAAAAT ATATGTAATT GCTGGACCAG GGTGTCAGGA TAATATCCTG TGGAGACCAC AAAAATAAAA TACTAAGCGA
TAAATCCATG AGGgtggatt ttaaactttg aaggggacgt tcactcattg tttgtatgtc gctcaaatag ttataaaaaa
atttgagaag atgtactaat atgtgatata tcacttcata aacatacaag ttaaaattca atttatatat attgtaacga
aaaaaataaa tttaattgta tttatacgtt aactagctag ctgtagttta atatattttt tcgttatgag atatataaat
tgaatttgaa ttcacatgtt tatgaagtga tatgccacaA GCAACAAAAA GATATTTTCT TAAGAGTTTA GAATAATTTC
CCGTAAACCT GCATATCATA TTCATCCTCC CCTCACGAGC AGATTGTTCC CTGCTTTCCC TATTTGAAAA TTTCCCGTAC
TCTGTCTGCA TGTTCAAAAC AGTAAGGTCG CTAGAAGCTT GTGCTTGGAC TCATGTGGCA ATTGGCATTT CGCTGCTTTC
CTTCGTGCAG GGTGGGCTGC TGGCTCAGAT CGGTGGGGTG CCGGACGGTT ACGCGGCGTG GGCCGGCCGG GAGCAGCTGC
ACAGTGGCGT CGCTGTCGCC GCCGACGAGC GGGCCAGCCG CGAGCGGTGG GTGCCGCAGA TGAACGCGGA GTGGGGCGCC
GGCAGCAAGC GACCCAGGGC GTCGCCTCCC TGCTTGTACT GGTGAAAAAA AAACGTGCGC TTATCAGCCA CAGCCAGTAC
GAAATGTACG ATGCTTGTGT ACCAGTGTAC TGAGGTAGTA GCGTTAGAAG ATTAGGAATT TAGTAGTGGA TGTTGATTTT
GAGCTTAACG CGTGTCTTGG ATGAATCCCT GACTCCTGAA TGTTTGGGGA ATTAATGTGA GTGGTAGTGT CCTCTTTGGG
CGGCAAAGAA TTATACGCCC CTTGCGAACA TGTCGAACTG TACGGTCTGC CATTTAATCT GCACGTTCAC CCCTC

Locus: Os04g0540200

Loading...

Locus: Os04g0540200

Loading...