Os04t0541700-01

Locus

Os04g0541700

Description

Similar to Homeobox-leucine zipper protein HOX22.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HOX22

CGSNL Gene Name

HOMEOBOX GENE 22

Oryzabase Gene Symbol Synonym(s)

Oshox22, OsHox22

Oryzabase Gene Name Synonym(s)

rice homeobox gene 22, Homeobox-leucine zipper protein HOX22, Homeodomain transcription factor HOX22, HD-ZIP protein HOX22

Transcript Evidence

AK109177 (DDBJ, Best hit)

Protein Evidence

Q7XUJ5 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: transcription regulatory region sequence-specific DNA binding (GO:0000976)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: protein binding (GO:0005515)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Helix-turn-helix motif, lambda-like repressor (IPR000047)

Homeobox (IPR001356)

Leucine zipper, homeobox-associated (IPR003106)

Homeodomain-like (IPR009057)

Homeodomain-related (IPR012287)

Homeobox, conserved site (IPR017970)

Full-length cDNA

002-155-H12 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0541700-01)

Others

Oryzabase (8459)

Transcript

908 bp

>Os04t0541700-01 Similar to Homeobox-leucine zipper protein HOX22.
acggaggagcagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggag
ccccgcgagaaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggcCATC
TGGTTCCAGAACAAGCGCGCGCGGTGGCGCTCCAAGCAGCTCGAGCACGACTACGCCGCA
CTCCGCTCCAAGTACGACGCCCTCCACTCCCGCGTCGAGTCCCTCAAGCAAGAGAAGCTC
GCTCTCACCGTCCAGTTGCACGAGCTAAGAGAGAGGCTGAGGGAACGGGAGGAGAGGAGC
GGCAACGGTGGTGCCGCCACGACGGCAGCAAGCAGCAGCAGCTGCAACGGATCAGGCAGC
GAGGAGGTCGACGACGACGACGACAAGAGGAACGCCGCCGCGGGGTGCCTGGACCTCGAG
CCGCCGGAGAGCTGCGTGCTCGGCGGCGCGACGTGCGCCACGCCGGCGGACGTGTCGGTG
GAGTCGGATCAGTGCGACGACCAGCTTGACTACGATGAGGGCTTGTTCCCGGAGTCCTTC
TGCGCCACGCCGGAGCTGTGGGAGCCATGGCCGCTCGTCGAGTGGAATGCGGTGGCTTGA
AAGACAGAGAGTAGTATATTACCCTAGGTTAATTTGTGTGTACATGTAGCTTAAAGTACG
TGGATCACGTCTCCTCGACTGATCTGCCGTCTCCCTTGGACAGAGAGGGAAAAGAGGGCC
GTGGCAATGACGTGTGGGGCCGGTTTGTAGATTGGGGTTGCAAGAGGAATCTCGTTGGAG
TAGTGGTGGTGGAAACCTTGGAAGCAATTAAGCCAATGGACTTTGTGTTTTGGATGGTGC
TAAAATGGAGAAAACTAGATCGAGCTCATTGGAAGAGTTGCATAGGAATTCAAGCATCTT
TTGTGGTC

CDS

570 bp

>Os04t0541700-01 Similar to Homeobox-leucine zipper protein HOX22.
atgttccacgcgcaccacgccaagctggagccccgcgagaaggcggagctggcgcgcgag
ctgggcctgcagccgcggcaggtggcCATCTGGTTCCAGAACAAGCGCGCGCGGTGGCGC
TCCAAGCAGCTCGAGCACGACTACGCCGCACTCCGCTCCAAGTACGACGCCCTCCACTCC
CGCGTCGAGTCCCTCAAGCAAGAGAAGCTCGCTCTCACCGTCCAGTTGCACGAGCTAAGA
GAGAGGCTGAGGGAACGGGAGGAGAGGAGCGGCAACGGTGGTGCCGCCACGACGGCAGCA
AGCAGCAGCAGCTGCAACGGATCAGGCAGCGAGGAGGTCGACGACGACGACGACAAGAGG
AACGCCGCCGCGGGGTGCCTGGACCTCGAGCCGCCGGAGAGCTGCGTGCTCGGCGGCGCG
ACGTGCGCCACGCCGGCGGACGTGTCGGTGGAGTCGGATCAGTGCGACGACCAGCTTGAC
TACGATGAGGGCTTGTTCCCGGAGTCCTTCTGCGCCACGCCGGAGCTGTGGGAGCCATGG
CCGCTCGTCGAGTGGAATGCGGTGGCTTGA

Protein

190 aa

>Os04t0541700-01 Similar to Homeobox-leucine zipper protein HOX22.
MFHAHHAKLEPREKAELARELGLQPRQVAIWFQNKRARWRSKQLEHDYAALRSKYDALHS
RVESLKQEKLALTVQLHELRERLREREERSGNGGAATTAASSSSCNGSGSEEVDDDDDKR
NAAAGCLDLEPPESCVLGGATCATPADVSVESDQCDDQLDYDEGLFPESFCATPELWEPW
PLVEWNAVA*

5'UTR

chr04:27124404..27124433 (+ strand) : 30 bp

CDS

chr04:27124434..27124658 (+ strand) : 225 bp

chr04:27124776..27125120 (+ strand) : 345 bp

3'UTR

chr04:27125121..27125428 (+ strand) : 308 bp

FASTA

>Os04t0541700-01 class=Sequence position=chr04:27124404..27125428 (+ strand)
acggaggagc agatacggtc gctggagtcc atgttccacg cgcaccacgc caagctggag ccccgcgaga aggcggagct
ggcgcgcgag ctgggcctgc agccgcggca ggtggcCATC TGGTTCCAGA ACAAGCGCGC GCGGTGGCGC TCCAAGCAGC
TCGAGCACGA CTACGCCGCA CTCCGCTCCA AGTACGACGC CCTCCACTCC CGCGTCGAGT CCCTCAAGCA AGAGAAGCTC
GCTCTCACCG TCCAGGTAAT TAACGATGAA TTAAGCAAGC TAGCTTAGCT ACTAATCGTA GGAACATGCA GATCATGTGT
TCCATAATTA ATTCAAACGC TAACTTGATT GCTCTTTGCA TGTAATATGC AGTTGCACGA GCTAAGAGAG AGGCTGAGGG
AACGGGAGGA GAGGAGCGGC AACGGTGGTG CCGCCACGAC GGCAGCAAGC AGCAGCAGCT GCAACGGATC AGGCAGCGAG
GAGGTCGACG ACGACGACGA CAAGAGGAAC GCCGCCGCGG GGTGCCTGGA CCTCGAGCCG CCGGAGAGCT GCGTGCTCGG
CGGCGCGACG TGCGCCACGC CGGCGGACGT GTCGGTGGAG TCGGATCAGT GCGACGACCA GCTTGACTAC GATGAGGGCT
TGTTCCCGGA GTCCTTCTGC GCCACGCCGG AGCTGTGGGA GCCATGGCCG CTCGTCGAGT GGAATGCGGT GGCTTGAAAG
ACAGAGAGTA GTATATTACC CTAGGTTAAT TTGTGTGTAC ATGTAGCTTA AAGTACGTGG ATCACGTCTC CTCGACTGAT
CTGCCGTCTC CCTTGGACAG AGAGGGAAAA GAGGGCCGTG GCAATGACGT GTGGGGCCGG TTTGTAGATT GGGGTTGCAA
GAGGAATCTC GTTGGAGTAG TGGTGGTGGA AACCTTGGAA GCAATTAAGC CAATGGACTT TGTGTTTTGG ATGGTGCTAA
AATGGAGAAA ACTAGATCGA GCTCATTGGA AGAGTTGCAT AGGAATTCAA GCATCTTTTG TGGTC

Locus: Os04g0541700

Loading...

Locus: Os04g0541700

Loading...