Os04t0541700-02

Locus

Os04g0541700

Description

Homeodomain-leucine zipper (HD-Zip) protein, Transcription factor, ABA-mediated drought and salt tolerance

RAP-DB Gene Symbol Synonym(s)

HOX22, Oshox22, OsHox22

RAP-DB Gene Name Synonym(s)

HOMEOBOX GENE 22, rice homeobox gene 22, Homeobox-leucine zipper protein HOX22, Homeodomain transcription factor HOX22, HD-ZIP protein HOX22

CGSNL Gene Symbol

HOX22

CGSNL Gene Name

HOMEOBOX GENE 22

Oryzabase Gene Symbol Synonym(s)

Oshox22, OsHox22

Oryzabase Gene Name Synonym(s)

rice homeobox gene 22, Homeobox-leucine zipper protein HOX22, Homeodomain transcription factor HOX22, HD-ZIP protein HOX22

Transcript Evidence

Inferred from literature

Protein Evidence

Q7XUJ5

Literature

PMID: 23109182

Note

Manual Curation

February 10, 2017

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: transcription factor activity, sequence-specific DNA binding (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Homeobox domain-like (IPR009057)

Homeobox domain (IPR001356)

Leucine zipper, homeobox-associated (IPR003106)

Helix-turn-helix motif (IPR000047)

Homeobox, conserved site (IPR017970)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Others

Oryzabase (8459)

Transcript

1230 bp

>Os04t0541700-02 Homeodomain-leucine zipper (HD-Zip) protein, Transcription factor, ABA-mediated drought and salt tolerance
GAGAGGGATGAATGGTCGAACACAGCTAGCTAGCTGGGCTAGGATCGCCATGGATCGGGG
TGACCACCACCACCTCCAGCAGCAGCACCAGTTCTTGATGCCACCGCCTGCGCCGGTGGT
GCCGCCGCAGCTGTGCATGCCGGCGATGATGGCGGACGAGCAGTACATGGACCTGGGCGg
tggcggggcggcggcggcgccggggaggggcggggccggggagaggaagcggcggttcac
ggaggagcagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggagcc
ccgcgagaaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggcCATCTG
GTTCCAGAACAAGCGCGCGCGGTGGCGCTCCAAGCAGCTCGAGCACGACTACGCCGCACT
CCGCTCCAAGTACGACGCCCTCCACTCCCGCGTCGAGTCCCTCAAGCAAGAGAAGCTCGC
TCTCACCGTCCAGTTGCACGAGCTAAGAGAGAGGCTGAGGGAACGGGAGGAGAGGAGCGG
CAACGGTGGTGCCGCCACGACGGCAGCAAGCAGCAGCAGCTGCAACGGATCAGGCAGCGA
GGAGGTCGACGACGACGACGACAAGAGGAACGCCGCCGCGGGGTGCCTGGACCTCGAGCC
GCCGGAGAGCTGCGTGCTCGGCGGCGCGACGTGCGCCACGCCGGCGGACGTGTCGGTGGA
GTCGGATCAGTGCGACGACCAGCTTGACTACGATGAGGGCTTGTTCCCGGAGTCCTTCTG
CGCCACGCCGGAGCTGTGGGAGCCATGGCCGCTCGTCGAGTGGAATGCGGTGGCTTGAAA
GACAGAGAGTAGTATATTACCCTAGGTTAATTTGTGTGTACATGTAGCTTAAAGTACGTG
GATCACGTCTCCTCGACTGATCTGCCGTCTCCCTTGGACAGAGAGGGAAAAGAGGGCCGT
GGCAATGACGTGTGGGGCCGGTTTGTAGATTGGGGTTGCAAGAGGAATCTCGTTGGAGTA
GTGGTGGTGGAAACCTTGGAAGCAATTAAGCCAATGGACTTTGTGTTTTGGATGGTGCTA
AAATGGAGAAAACTAGATCGAGCTCATTGGAAGAGTTGCATAGGAATTCAAGCATCTTTT
GTGGTCACTTCGAATTCGGATTTAGTAGTAATCTATTCGAAAGATGTTCAATTGACGATA
TTATTAAACTAGTTTTATATCTACACATAA

CDS

831 bp

>Os04t0541700-02 Homeodomain-leucine zipper (HD-Zip) protein, Transcription factor, ABA-mediated drought and salt tolerance
ATGAATGGTCGAACACAGCTAGCTAGCTGGGCTAGGATCGCCATGGATCGGGGTGACCAC
CACCACCTCCAGCAGCAGCACCAGTTCTTGATGCCACCGCCTGCGCCGGTGGTGCCGCCG
CAGCTGTGCATGCCGGCGATGATGGCGGACGAGCAGTACATGGACCTGGGCGgtggcggg
gcggcggcggcgccggggaggggcggggccggggagaggaagcggcggttcacggaggag
cagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggagccccgcgag
aaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggcCATCTGGTTCCAG
AACAAGCGCGCGCGGTGGCGCTCCAAGCAGCTCGAGCACGACTACGCCGCACTCCGCTCC
AAGTACGACGCCCTCCACTCCCGCGTCGAGTCCCTCAAGCAAGAGAAGCTCGCTCTCACC
GTCCAGTTGCACGAGCTAAGAGAGAGGCTGAGGGAACGGGAGGAGAGGAGCGGCAACGGT
GGTGCCGCCACGACGGCAGCAAGCAGCAGCAGCTGCAACGGATCAGGCAGCGAGGAGGTC
GACGACGACGACGACAAGAGGAACGCCGCCGCGGGGTGCCTGGACCTCGAGCCGCCGGAG
AGCTGCGTGCTCGGCGGCGCGACGTGCGCCACGCCGGCGGACGTGTCGGTGGAGTCGGAT
CAGTGCGACGACCAGCTTGACTACGATGAGGGCTTGTTCCCGGAGTCCTTCTGCGCCACG
CCGGAGCTGTGGGAGCCATGGCCGCTCGTCGAGTGGAATGCGGTGGCTTGA

Protein

277 aa

>Os04t0541700-02 Homeodomain-leucine zipper (HD-Zip) protein, Transcription factor, ABA-mediated drought and salt tolerance
MNGRTQLASWARIAMDRGDHHHLQQQHQFLMPPPAPVVPPQLCMPAMMADEQYMDLGGGG
AAAAPGRGGAGERKRRFTEEQIRSLESMFHAHHAKLEPREKAELARELGLQPRQVAIWFQ
NKRARWRSKQLEHDYAALRSKYDALHSRVESLKQEKLALTVQLHELRERLREREERSGNG
GAATTAASSSSCNGSGSEEVDDDDDKRNAAAGCLDLEPPESCVLGGATCATPADVSVESD
QCDDQLDYDEGLFPESFCATPELWEPWPLVEWNAVA*

5'UTR

chr04:27124166..27124172 (+ strand) : 7 bp

CDS

chr04:27124173..27124658 (+ strand) : 486 bp

chr04:27124776..27125120 (+ strand) : 345 bp

3'UTR

chr04:27125121..27125512 (+ strand) : 392 bp

FASTA

>Os04t0541700-02 class=Sequence position=chr04:27124166..27125512 (+ strand)
GAGAGGGATG AATGGTCGAA CACAGCTAGC TAGCTGGGCT AGGATCGCCA TGGATCGGGG TGACCACCAC CACCTCCAGC
AGCAGCACCA GTTCTTGATG CCACCGCCTG CGCCGGTGGT GCCGCCGCAG CTGTGCATGC CGGCGATGAT GGCGGACGAG
CAGTACATGG ACCTGGGCGg tggcggggcg gcggcggcgc cggggagggg cggggccggg gagaggaagc ggcggttcac
ggaggagcag atacggtcgc tggagtccat gttccacgcg caccacgcca agctggagcc ccgcgagaag gcggagctgg
cgcgcgagct gggcctgcag ccgcggcagg tggcCATCTG GTTCCAGAAC AAGCGCGCGC GGTGGCGCTC CAAGCAGCTC
GAGCACGACT ACGCCGCACT CCGCTCCAAG TACGACGCCC TCCACTCCCG CGTCGAGTCC CTCAAGCAAG AGAAGCTCGC
TCTCACCGTC CAGGTAATTA ACGATGAATT AAGCAAGCTA GCTTAGCTAC TAATCGTAGG AACATGCAGA TCATGTGTTC
CATAATTAAT TCAAACGCTA ACTTGATTGC TCTTTGCATG TAATATGCAG TTGCACGAGC TAAGAGAGAG GCTGAGGGAA
CGGGAGGAGA GGAGCGGCAA CGGTGGTGCC GCCACGACGG CAGCAAGCAG CAGCAGCTGC AACGGATCAG GCAGCGAGGA
GGTCGACGAC GACGACGACA AGAGGAACGC CGCCGCGGGG TGCCTGGACC TCGAGCCGCC GGAGAGCTGC GTGCTCGGCG
GCGCGACGTG CGCCACGCCG GCGGACGTGT CGGTGGAGTC GGATCAGTGC GACGACCAGC TTGACTACGA TGAGGGCTTG
TTCCCGGAGT CCTTCTGCGC CACGCCGGAG CTGTGGGAGC CATGGCCGCT CGTCGAGTGG AATGCGGTGG CTTGAAAGAC
AGAGAGTAGT ATATTACCCT AGGTTAATTT GTGTGTACAT GTAGCTTAAA GTACGTGGAT CACGTCTCCT CGACTGATCT
GCCGTCTCCC TTGGACAGAG AGGGAAAAGA GGGCCGTGGC AATGACGTGT GGGGCCGGTT TGTAGATTGG GGTTGCAAGA
GGAATCTCGT TGGAGTAGTG GTGGTGGAAA CCTTGGAAGC AATTAAGCCA ATGGACTTTG TGTTTTGGAT GGTGCTAAAA
TGGAGAAAAC TAGATCGAGC TCATTGGAAG AGTTGCATAG GAATTCAAGC ATCTTTTGTG GTCACTTCGA ATTCGGATTT
AGTAGTAATC TATTCGAAAG ATGTTCAATT GACGATATTA TTAAACTAGT TTTATATCTA CACATAA

Locus: Os04g0541700

Loading...

Locus: Os04g0541700

Loading...