Os04t0542200-01

Locus

Os04g0542200

Description

Similar to H0501D11.7 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

YSL9

CGSNL Gene Name

YELLOW STRIP-LIKE GENE 9

Oryzabase Gene Symbol Synonym(s)

OsYSL9, OsYs13

Oryzabase Gene Name Synonym(s)

rice YSL (yellow stripe-like) gene 9, Probable metal-nicotianamine transporter YSL9, Protein YELLOW STRIPE LIKE 9, yellow stripe 1-like transporter 9

Transcript Evidence

AK120923 (DDBJ, Best hit)

Protein Evidence

Q01IJ7 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Functional domain (InterPro)

Oligopeptide transporter OPT superfamily (IPR004813)

Full-length cDNA

J023035G16 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0542200-01)

Others

Oryzabase (8367)

Transcript

2537 bp

>Os04t0542200-01 Similar to H0501D11.7 protein.
GTGACGTGCTATTCAGTTCTCTTTCTCACCTTCAGTTTCGTTTGGCTCGCTGTTCTTGTC
TTTTCAGTTGGAGCAAGAGCAAGAGAGAATCCAGGCTAATTCAGGAGAGGCGGAGGAAGC
GGCAGCCCGGGCCGCCGCGCCTCGAGCTGGTGGTAGCGCACCCGCGGGAGGAGGAGATGG
CCGGGCTCGACGGCGGCGGCGACGCCGAGGAGGGGGCCACGCATGCCCGCGGCGGCGGCG
GCGCGCCGCCGCCGTGGCGGGAGCAGCTGACGGCGCGCGGGCTGGTGGCGAGCCTGGCCG
TGGGCGCCATGTACAGCGTCATCGTGATGAAGCTGAACCTTACCACGGGCCTCGTCCCCA
CGCTCAACGTCTCAGCCGCGCTCATCGCCTTCGTCGTCCTCCGCGGCTGGACGCAGGCGC
TCGCCCGCCTCGGCTTCGCCGCCCGCCCGTTCACGCGGCAGGAGAACACCGTCGTCCAGA
CCTGCGCCGTCGCCTGCTACAGCATCGCAGTTGGAGGTGGGTTTGGTTCTTACTTGCTTG
GGCTCAACAAGAGGACTTACGAGATGGCGGGCGAGGACACGGAGGGCAACGTGCCGGGGA
GCTACAAGGAGCCCGGCATTGCGTGGATGACTGGATTCCTTCTCGCCGTCAGCTTCGTCG
GACTTCTCGCTCTCGTCCCTCTTAGGAAGGTCATGATAATTGACTACAAATTAACTTACC
CAAGTGGGACTGCAACAGCTGTGCTTATAAATGGATTCCACACACCTCATGGGGATGCAA
TGGCAAAGCAGCAAGTAAATGGATTCACCAAATATTTTGCTATGAGTTTCTTTTGGAGCT
TCTTCCAGTGGTTTTACTCTGGTGGAGACAATTGTGGGTTCTCGCAGTTTCCAACTTTTG
GACTAAAAGCTTGGCAACAAACATTCTTCTTCGATTTCAGTCTCACATATGTTGGGGCAG
GGATGATTTGCTCCCACCTTGTTAATCTGTCTCTCCTACTCGGCGCCATTCTCTCATGGG
GAGTAATGTGGCCACTGATCAGTGATTTGAAAGGGGATTGGTATTCAGCAGATATACCTG
AAAGCAGCATGAAAAGCCTGCAAGGGTACAAGGCCTTCATCTGTGTAGCTCTCATCCTAG
GTGATGGCCTATACAATTTTGTGAAGATAGTTGCACTCACTATTAAGAATCTGTTTGATA
GCTCAAAACTGAAGAATGCAAAGAAGGGGGAAGACATGCCAGTGCTCGATGAACTTCATC
GTAATGAAGTTTTTACAACAGACAATATTCCTTCCTGGCTAGCCTTCTCTGGTTATCTTG
GATTAACTTTTATTGCAGTAATTGCCATTCCCATGATGTTCCATGAGATGAAGTGGTATT
ATGTTGTCATAGCATACTTATTGGCGCCTGCCCTTGGTTTCTGCAATGCCTATGGAGCAG
GCCTAACTGACATCAATATGGCCTACAATTATGGAAAGATTGCCCTCTTCATTCTTGCAG
CCTGGGCTGGGAAAGACTCTGGTGTAGTTGCTGGCCTAGTAGGCTGTGGTTTGGTGAAAT
CGCTGGTGTCCATATCTGCTGATCTGATGCATGATTTCAAGACGGGACATCTAACATTAA
CATCACCGAGATCGATGATTATTGCTCAGGCCATTGGAACTGTCATGGGTTGTGTAATTT
CACCACTAACTTTCTTCTTGTTCTACAGTGCCTTTGACATTGGCAACCCAGAAGGGTACT
GGAAAGCACCATATGCTCTAGTCTACCGAAACATGGCGATTCTTGGTGTTGAGGGCTTCT
CTGCTCTGCCCCAGCATTGCTTGCAGCTCTGCTATGGGTTTTTTGGCTTTGCAGTGGCAG
CTAACCTTACGAGGGACCTTTGCCCACCGAAGTATGGGAGATGGGTTCCCCTACCGATGG
CAATGGGGGTTCCTTTCCTGGTTGGTGCAAGCTTTGCCATCGACATGTGTATCGGGAGCC
TGATAGTCTTCACCTGGCATATAATTGACAAAAGCAAAGCAGCACTAATGGTGCCAGCAG
TTGCATCTGGTTTGATATGCGGGGATGGTCTTTGGATCTTCCCTGCGTCCTTGCTTGCTT
TGGCCAAGATCAGCCCACCAATGTGCATGGCATTTAGGTCTACAAACTAGAGGAGTAGCA
GGGATTATAATTACATGGCAGTTCCATCTACTACAGGAAAGATGCAGCAATGCAATAATG
AAGTATTATATGGGATTCCTGGAGGTACCTGTGCAGTAAATATTGGAAAGGTACCAAACA
TTGTTACCATTTCCATGTCAATGAAGTAAGACAACAGATTCAAGATAATTCATCTCATAA
CAATGGCGTATTTTTATTGCCTCATCTCTTACCAATGTGATTTATGGTTTTAGCCTGTAG
GCGCTAATAGAAGAAATTTTGTATAGTAGAGAAATGTTTAGTGTATACATGTATATATTT
GGTGATAAGTTGGACCCGAAGACCGAATATTGTAACAGGTCTCTTTCAAGATCAGCTGAT
CCAATTCTTACTTTGCC

CDS

2148 bp

>Os04t0542200-01 Similar to H0501D11.7 protein.
GACGTGCTATTCAGTTCTCTTTCTCACCTTCAGTTTCGTTTGGCTCGCTGTTCTTGTCTT
TTCAGTTGGAGCAAGAGCAAGAGAGAATCCAGGCTAATTCAGGAGAGGCGGAGGAAGCGG
CAGCCCGGGCCGCCGCGCCTCGAGCTGGTGGTAGCGCACCCGCGGGAGGAGGAGATGGCC
GGGCTCGACGGCGGCGGCGACGCCGAGGAGGGGGCCACGCATGCCCGCGGCGGCGGCGGC
GCGCCGCCGCCGTGGCGGGAGCAGCTGACGGCGCGCGGGCTGGTGGCGAGCCTGGCCGTG
GGCGCCATGTACAGCGTCATCGTGATGAAGCTGAACCTTACCACGGGCCTCGTCCCCACG
CTCAACGTCTCAGCCGCGCTCATCGCCTTCGTCGTCCTCCGCGGCTGGACGCAGGCGCTC
GCCCGCCTCGGCTTCGCCGCCCGCCCGTTCACGCGGCAGGAGAACACCGTCGTCCAGACC
TGCGCCGTCGCCTGCTACAGCATCGCAGTTGGAGGTGGGTTTGGTTCTTACTTGCTTGGG
CTCAACAAGAGGACTTACGAGATGGCGGGCGAGGACACGGAGGGCAACGTGCCGGGGAGC
TACAAGGAGCCCGGCATTGCGTGGATGACTGGATTCCTTCTCGCCGTCAGCTTCGTCGGA
CTTCTCGCTCTCGTCCCTCTTAGGAAGGTCATGATAATTGACTACAAATTAACTTACCCA
AGTGGGACTGCAACAGCTGTGCTTATAAATGGATTCCACACACCTCATGGGGATGCAATG
GCAAAGCAGCAAGTAAATGGATTCACCAAATATTTTGCTATGAGTTTCTTTTGGAGCTTC
TTCCAGTGGTTTTACTCTGGTGGAGACAATTGTGGGTTCTCGCAGTTTCCAACTTTTGGA
CTAAAAGCTTGGCAACAAACATTCTTCTTCGATTTCAGTCTCACATATGTTGGGGCAGGG
ATGATTTGCTCCCACCTTGTTAATCTGTCTCTCCTACTCGGCGCCATTCTCTCATGGGGA
GTAATGTGGCCACTGATCAGTGATTTGAAAGGGGATTGGTATTCAGCAGATATACCTGAA
AGCAGCATGAAAAGCCTGCAAGGGTACAAGGCCTTCATCTGTGTAGCTCTCATCCTAGGT
GATGGCCTATACAATTTTGTGAAGATAGTTGCACTCACTATTAAGAATCTGTTTGATAGC
TCAAAACTGAAGAATGCAAAGAAGGGGGAAGACATGCCAGTGCTCGATGAACTTCATCGT
AATGAAGTTTTTACAACAGACAATATTCCTTCCTGGCTAGCCTTCTCTGGTTATCTTGGA
TTAACTTTTATTGCAGTAATTGCCATTCCCATGATGTTCCATGAGATGAAGTGGTATTAT
GTTGTCATAGCATACTTATTGGCGCCTGCCCTTGGTTTCTGCAATGCCTATGGAGCAGGC
CTAACTGACATCAATATGGCCTACAATTATGGAAAGATTGCCCTCTTCATTCTTGCAGCC
TGGGCTGGGAAAGACTCTGGTGTAGTTGCTGGCCTAGTAGGCTGTGGTTTGGTGAAATCG
CTGGTGTCCATATCTGCTGATCTGATGCATGATTTCAAGACGGGACATCTAACATTAACA
TCACCGAGATCGATGATTATTGCTCAGGCCATTGGAACTGTCATGGGTTGTGTAATTTCA
CCACTAACTTTCTTCTTGTTCTACAGTGCCTTTGACATTGGCAACCCAGAAGGGTACTGG
AAAGCACCATATGCTCTAGTCTACCGAAACATGGCGATTCTTGGTGTTGAGGGCTTCTCT
GCTCTGCCCCAGCATTGCTTGCAGCTCTGCTATGGGTTTTTTGGCTTTGCAGTGGCAGCT
AACCTTACGAGGGACCTTTGCCCACCGAAGTATGGGAGATGGGTTCCCCTACCGATGGCA
ATGGGGGTTCCTTTCCTGGTTGGTGCAAGCTTTGCCATCGACATGTGTATCGGGAGCCTG
ATAGTCTTCACCTGGCATATAATTGACAAAAGCAAAGCAGCACTAATGGTGCCAGCAGTT
GCATCTGGTTTGATATGCGGGGATGGTCTTTGGATCTTCCCTGCGTCCTTGCTTGCTTTG
GCCAAGATCAGCCCACCAATGTGCATGGCATTTAGGTCTACAAACTAG

Protein

715 aa

>Os04t0542200-01 Similar to H0501D11.7 protein.
DVLFSSLSHLQFRLARCSCLFSWSKSKRESRLIQERRRKRQPGPPRLELVVAHPREEEMA
GLDGGGDAEEGATHARGGGGAPPPWREQLTARGLVASLAVGAMYSVIVMKLNLTTGLVPT
LNVSAALIAFVVLRGWTQALARLGFAARPFTRQENTVVQTCAVACYSIAVGGGFGSYLLG
LNKRTYEMAGEDTEGNVPGSYKEPGIAWMTGFLLAVSFVGLLALVPLRKVMIIDYKLTYP
SGTATAVLINGFHTPHGDAMAKQQVNGFTKYFAMSFFWSFFQWFYSGGDNCGFSQFPTFG
LKAWQQTFFFDFSLTYVGAGMICSHLVNLSLLLGAILSWGVMWPLISDLKGDWYSADIPE
SSMKSLQGYKAFICVALILGDGLYNFVKIVALTIKNLFDSSKLKNAKKGEDMPVLDELHR
NEVFTTDNIPSWLAFSGYLGLTFIAVIAIPMMFHEMKWYYVVIAYLLAPALGFCNAYGAG
LTDINMAYNYGKIALFILAAWAGKDSGVVAGLVGCGLVKSLVSISADLMHDFKTGHLTLT
SPRSMIIAQAIGTVMGCVISPLTFFLFYSAFDIGNPEGYWKAPYALVYRNMAILGVEGFS
ALPQHCLQLCYGFFGFAVAANLTRDLCPPKYGRWVPLPMAMGVPFLVGASFAIDMCIGSL
IVFTWHIIDKSKAALMVPAVASGLICGDGLWIFPASLLALAKISPPMCMAFRSTN*

5'UTR

chr04:27158798..27158799 (- strand) : 2 bp

CDS

chr04:27158696..27158797 (- strand) : 102 bp

chr04:27157916..27158328 (- strand) : 413 bp

chr04:27157648..27157819 (- strand) : 172 bp

chr04:27156447..27156544 (- strand) : 98 bp

chr04:27156225..27156359 (- strand) : 135 bp

chr04:27155921..27156110 (- strand) : 190 bp

chr04:27155725..27155839 (- strand) : 115 bp

chr04:27154726..27155648 (- strand) : 923 bp

3'UTR

chr04:27154339..27154725 (- strand) : 387 bp

FASTA

>Os04t0542200-01 class=Sequence position=chr04:27154339..27158799 (- strand)
GTGACGTGCT ATTCAGTTCT CTTTCTCACC TTCAGTTTCG TTTGGCTCGC TGTTCTTGTC TTTTCAGTTG GAGCAAGAGC
AAGAGAGAAT CCAGGCTAAT TCAGGTGGGT CTTTTTTACA TTATCTTTCT GGAATCCTCG ATACCACACT GAAGATAAAA
GGCAGTGATT TTCTTTGGAG AATCACCCAT AAAAATTTCA TCTTTTTCTT TGCCCCTATG GATTTCTTGC ACTGATCCTT
GGCGAGAGAG CGCACTTGTT CATAGCTTCG TTGCTTAGCA CAACGGATGT AGAAGAACAC AAGTGAGGAG CTCACTAGCT
AGCATCATAT TCGTGCTAAC TCATCCTCGT ACTGAAAAAA AAAAGATCTT TTTGTTTCAC CGACCCTTCA TTCTCTCATT
CACATGCCTC CGCTGGAACT CGGACACGGG GGTGAATCTG ACGCCGGAAA ATTCTTTCCG CCATGAAGCA GGAGAGGCGG
AGGAAGCGGC AGCCCGGGCC GCCGCGCCTC GAGCTGGTGG TAGCGCACCC GCGGGAGGAG GAGATGGCCG GGCTCGACGG
CGGCGGCGAC GCCGAGGAGG GGGCCACGCA TGCCCGCGGC GGCGGCGGCG CGCCGCCGCC GTGGCGGGAG CAGCTGACGG
CGCGCGGGCT GGTGGCGAGC CTGGCCGTGG GCGCCATGTA CAGCGTCATC GTGATGAAGC TGAACCTTAC CACGGGCCTC
GTCCCCACGC TCAACGTCTC AGCCGCGCTC ATCGCCTTCG TCGTCCTCCG CGGCTGGACG CAGGCGCTCG CCCGCCTCGG
CTTCGCCGCC CGCCCGTTCA CGCGGCAGGA GAACACCGTC GTCCAGACCT GCGCCGTCGC CTGCTACAGC ATCGCAGTTG
GAGGCCAGGA CCACCCCCCA TTGCATCCAT CCTCCATTCG TCGTCTACCT AGTCTAATGG AGATCCCGAC TGATTGGTTC
TTTGGATCTT TCTGTGCAGG TGGGTTTGGT TCTTACTTGC TTGGGCTCAA CAAGAGGACT TACGAGATGG CGGGCGAGGA
CACGGAGGGC AACGTGCCGG GGAGCTACAA GGAGCCCGGC ATTGCGTGGA TGACTGGATT CCTTCTCGCC GTCAGCTTCG
TCGGACTTCT CGCTCTCGTC CCTCTTAGGA AGGTCAGTGA GCTTCCACAG CCTTACTCTG TATcttcggt agttctgcca
tttgaccagt tctgttcgtg ttttactgct tagtttatat gtgtagatct aatgatgcgc tcatgctagt ttatatctgc
aatgtcttga tttatttata gaataaatta aatcattata tgcttataat ttcaacagtt CTGCCATTTG ACCACGGTTC
GCTGTAGCTC CTTACTCCTT AGAACTGCAA TTCTACATTT CATAGGCGTT TTTGTCGTTC ACCAGTTCAC CCTTGTGAGA
ATTTCACAAA ATTGTGGTAA ACTGACCATC ATCTCCATTT CAGCCTTTTC TATCTTTTGT CCCTTCAACA TTTCGTAGGT
GTTTTAATTT CATTTCACGA TGTCACAGAT TACATAAGCT AAAAAAAAGG ACAATTATGC CTGTATTTAG CTAGGTGATA
GAGTTGAAGT GCAGCTAGTA TTTTAACGTA TCTGATTGAT GGCCTTATGG TCCCTGTTGA ATCTGGACTG CTGATTGAAT
TGTTCTTGTA TGGTCTTGTT TAGTTGTTTG AAATTGGCGT GCTGAATGAA TCGTTCTGGT ATATTAAATA AATTTGTCTC
TGTCATGAAA CCTCTTTCAG TCTGGCTTTA TTAAACCACC TAGTTGGTTA TTGGTTAAGA CATACCAACA TTTTTGCTTA
ATCGATTGAT AGTGATTTGT GCTGAAACAA ACAATACCAA CTCATTAGCG TGTGGTACTT CTCTAGTCCC CTGAAGAAAA
TATAGCTATT TTGCTTGTGG TTTGAGTTGT ACTTTTATAA ATAAAATATA TTTTTTTAAT TCTGAAAAAA AGCATACTTA
TTATTTGAAT CTTGAGTTGC AGTTGAATTT AATTGAAAGC ATAATTTGAA GTCCACATGC AAAGACTTAT TATGCGTGAT
TCTGGACATA TTCTCCTTTT CATTTCACAA CATATTTATC TTGTGAATAC ATAAAAAATG AACAGCTGGC AGTGCTTTTC
CACATGTAAA TGGATGATTT CATTTGTTAC CAAACTTAGT AAAATTCCAG ATCTTGATAA TTTCCATTTG TTTCTTAAAC
TTGGTAAAAT TTCAGGTCAT GATAATTGAC TACAAATTAA CTTACCCAAG TGGGACTGCA ACAGCTGTGC TTATAAATGG
ATTCCACACA CCTCATGGGG ATGCAATGGC AAAGTATGTG GTTCTCTAAC ATAACTCATA ATGAGTTCTA CTATTCATTA
TAAAATTTCA GTTAACTGAA CGTGTTTTTT GGCACATCAG GCAGCAAGTA AATGGATTCA CCAAATATTT TGCTATGAGT
TTCTTTTGGA GCTTCTTCCA GTGGTTTTAC TCTGGTGGAG ACAATTGTGG GTTCTCGCAG TTTCCAACTT TTGGACTAAA
AGCTTGGCAA CAAACGTAAC AACAATCACT TAGCTCATTA TTCTATTAAA TAAATTTTGA CCAACAATAG TGTCACCTGA
TTTGTTCAAA AAACAAGTTC ATCTGATTCA AAACTTTTTG GGTTATCAGA TTCTTCTTCG ATTTCAGTCT CACATATGTT
GGGGCAGGGA TGATTTGCTC CCACCTTGTT AATCTGTCTC TCCTACTCGG CGCCATTCTC TCATGGGGAG TAATGTGGCC
ACTGATCAGT GATTTGAAAG GGGATTGGTA TTCAGCAGAT ATACCTGAAA GCAGCATGAA AAGCCTGCAA GGGTACAAGG
TTAGTTTCGT CATTTTATTT TGGTAGTGTA CAAGTATAGT ATGATCTTTT GATTCTTACC ACCTCATATA TATTCTTTAG
GCCTTCATCT GTGTAGCTCT CATCCTAGGT GATGGCCTAT ACAATTTTGT GAAGATAGTT GCACTCACTA TTAAGAATCT
GTTTGATAGC TCAAAACTGA AGAATGCAAA GAAGGGTAAA TAATCTGACA GAACTCAATA TGACCTTTCT AGTTTATATA
TGATCTGATA TAAGGTGTAT TCCACTTACA GGGGAAGACA TGCCAGTGCT CGATGAACTT CATCGTAATG AAGTTTTTAC
AACAGACAAT ATTCCTTCCT GGCTAGCCTT CTCTGGTTAT CTTGGATTAA CTTTTATTGC AGTAATTGCC ATTCCCATGA
TGTTCCATGA GATGAAGTGG TATTATGTTG TCATAGCATA CTTATTGGCG CCTGCCCTTG GTTTCTGCAA TGCCTATGGA
GCAGGCCTAA CTGACATCAA TATGGCCTAC AATTATGGAA AGATTGCCCT CTTCATTCTT GCAGCCTGGG CTGGGAAAGA
CTCTGGTGTA GTTGCTGGCC TAGTAGGCTG TGGTTTGGTG AAATCGCTGG TGTCCATATC TGCTGATCTG ATGCATGATT
TCAAGACGGG ACATCTAACA TTAACATCAC CGAGATCGAT GATTATTGCT CAGGCCATTG GAACTGTCAT GGGTTGTGTA
ATTTCACCAC TAACTTTCTT CTTGTTCTAC AGTGCCTTTG ACATTGGCAA CCCAGAAGGG TACTGGAAAG CACCATATGC
TCTAGTCTAC CGAAACATGG CGATTCTTGG TGTTGAGGGC TTCTCTGCTC TGCCCCAGCA TTGCTTGCAG CTCTGCTATG
GGTTTTTTGG CTTTGCAGTG GCAGCTAACC TTACGAGGGA CCTTTGCCCA CCGAAGTATG GGAGATGGGT TCCCCTACCG
ATGGCAATGG GGGTTCCTTT CCTGGTTGGT GCAAGCTTTG CCATCGACAT GTGTATCGGG AGCCTGATAG TCTTCACCTG
GCATATAATT GACAAAAGCA AAGCAGCACT AATGGTGCCA GCAGTTGCAT CTGGTTTGAT ATGCGGGGAT GGTCTTTGGA
TCTTCCCTGC GTCCTTGCTT GCTTTGGCCA AGATCAGCCC ACCAATGTGC ATGGCATTTA GGTCTACAAA CTAGAGGAGT
AGCAGGGATT ATAATTACAT GGCAGTTCCA TCTACTACAG GAAAGATGCA GCAATGCAAT AATGAAGTAT TATATGGGAT
TCCTGGAGGT ACCTGTGCAG TAAATATTGG AAAGGTACCA AACATTGTTA CCATTTCCAT GTCAATGAAG TAAGACAACA
GATTCAAGAT AATTCATCTC ATAACAATGG CGTATTTTTA TTGCCTCATC TCTTACCAAT GTGATTTATG GTTTTAGCCT
GTAGGCGCTA ATAGAAGAAA TTTTGTATAG TAGAGAAATG TTTAGTGTAT ACATGTATAT ATTTGGTGAT AAGTTGGACC
CGAAGACCGA ATATTGTAAC AGGTCTCTTT CAAGATCAGC TGATCCAATT CTTACTTTGC C

Locus: Os04g0542200

Loading...

Locus: Os04g0542200

Loading...