Os04t0544100-01

Locus

Os04g0544100

Description

Similar to SET domain-containing protein SET104.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET20, SDG703, OsSUVH5

Oryzabase Gene Name Synonym(s)

SET protein 20, SUVH Histone Methyltransferase 5

Transcript Evidence

AK066297 (DDBJ, Best hit)

Protein Evidence

NP_001105193.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: histone lysine methylation (GO:0034968)

Cellular Component: nucleus (GO:0005634)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Molecular Function: histone-lysine N-methyltransferase activity (GO:0018024)

Molecular Function: histone binding (GO:0042393)

Functional domain (InterPro)

SET domain (IPR001214)

SRA-YDG (IPR003105)

Post-SET domain (IPR003616)

Pre-SET domain (IPR007728)

Full-length cDNA

J013059A21 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0544100-01)

RiceXPro (AK066297)

Others

Oryzabase (13385)

KEGG (Os04t0544100-01)

Transcript

2711 bp

>Os04t0544100-01 Similar to SET domain-containing protein SET104.
AGGAGAACCCCCACCCCACCCACCTCGCCCCACTCCGCCGCGCCCCCTCCCCGCTGCCTC
CGTGGAGCGTCATCTCCGCGTGCAGGGTTAGAGGCTTCTGGTGGTGGTGGGGGCAGTGCG
GGGGGCGTTGGATGGGGATCCCGGAGGTGGTGGTGCCGCCGAGGGCGGCCGGCCCGCGGA
GGTACAAGGGGCTCGTGCCGTGGCGCTTCCAGCCGGGCTTCGTCAGGCCGCCTCCGGTCA
AGCCCCCTGCCGCCGCCGCCGCCGTTGCCGGAGGAGGGGTCGCGGGCACGCCCGGCGGCA
AGGGTCGCGGGTTGGGGGCGTCGGGGGAAGGCGTCGGGTCCAGTGGAGGCCGGGGAGATC
CTCAATCGAGGAGATGCACCCGCAGCGCGAGCGCGAAGGGCTCTGGTGATGCGCGGAGCG
TGGAGGAGGGCGGTCCCCGTGTTGCCGGAGACGACGGCGGTTCGGGCAAATCCGGCGTCG
CGGCGGAGGGCTCCGGATTTGAGGGTTTGAGGAATGGCAGGGGCGGTGGCGTTGGAACGG
CAGCTGCCGAAGATTGTGGTTTGGAGAAGTCCAACCCCGATGGCATCGTCGGAGATGCTG
ATGTGCATCTTGAGAGCGGCAGCGATGCAAGAGATGGGGAATGCGTTTCTGAGGGTTTGA
AGAAGCCTTGTGTAAATAATAGCAATGGTTCTTCTGCCGCGGATTGCGCGCCGAAGGTGA
AAAAGGGAAATGACAGTGGCAATGGAGGTGCCGATGAGTGTAATGCTGCAGCCAAAAGTA
GCAACTTAGCATGTCCTGGCAACAATGGCGACGAAACGAATCGTAAGGGGCGGAAGGTAG
TACTTCCATGGAGGTTCCAGGTTGGGTTCAAGCGGTCGTTCTCGAAAGCTTTCTGCTCCG
ATAGTGAATCTTCAGGGCCCTCTGGTACTCAATTCTACAGAGCCCAAGACTCTTCGACAC
CGTGCACTCCAGCAACAAGAAGTTCTGTCCGGTGTTATGCGAGTGCTCATTCTGGTGTTA
GAGTCTCGGCCATGCGTGATTTCTCAGTGAAAGGTGAGAAGGAAACATCAACTCCATATA
AGAAGAGCAAAACTGGCATGGATGGTCCTAGTCAAGGGATGCCAAAGAATGGAGTTGTcc
tcgctagggaaaacattatgggatctctgcagaattttcgcttaatttacagggaccttt
tggatgaagaagaagagaagtcgacagaagcagtgattagacctgatctacaagcttaca
gaattttcagggagcggttcatcacagactgcgatgagaagaaatatattggcaatgtgc
ctggaatcaaagttggtgatatcttccacttgagggtagagctttgtgttgttggtcttc
atcgcccacaccgggtgggtgtagatcatatcaaacaggaggatgggactTGCATAGCTG
TTAGCATTGTATCATATGCACAATCTTCCGATATTAAGAATAATTTGGATGTCTTGGTGT
ATTCTGGAGCAATGACAGCTATAGCCAATCAGAAGATAGAGGGTACCAACTTAGCACTCA
AGAAGAGTATGGACACTAACACACCAGTCCGTGTTATCCATGGTTTCGTCACTCACCTCA
ATGGAAACTGCCAGCGAAAGAAGATCCCTACTTATATATATGGGGGTTTATATATAGTCG
AGAAATACTGGAGGGAGAAAGAGGGTAATGATCGTTATGTTTATATGTTCCGACTGAGAA
GAATGGCAGGTCAGAAACACATTGACATCCAAGACATTCTGAATTCAGGACAAGCTGAAT
CATATGGTGGTATTATCATAAAAGATATATCCCGAGGATTGGAGAAGATCCCTGTATCTG
TTGTTAATTCAATATCTGATGAGTACCCAATGCCCTATCGCTACATTGCACACCTGCAGT
ACCCCCGTAACTACCAGCCAGCACCTCCAGCAGGCTGTGGTTGTGTTGGTGGATGCTCAG
ATTCTAAAAGGTGTGCATGTGCAGTGAAAAATGGTGGGGAGATTCCTTTCAATGATAAAG
GCCGCATCTTAGAAGCAAAACCTCTTGTTTATGAGTGTGGACCTTCATGCAAGTGCCCTC
CTACATGTCATAACAGAGTTGGTCAACATGGCCTTAGGTTTCGTTTGCAAGTCTTCAAAA
CCAAATTGATGGGCTGGGGAGTAAGAACTCTTGACTTCATACCATCTGGAAGCTTTGTAT
GTGAATACATTGGAGAAGTGTTGGAGGATGAAGAGGCACAGAAAAGGTCGACCGATGAAT
ACTTATTCGCTATTGGTCATAATTATTATGATGAAGCCCTTTGGGAGGGCCTATCAAGAT
CCATACCCTCACTTCAGAAGGGTCCTGATAAAGATGAGGAAGCTGGCTTTGCTGTTGATG
CTTCAAAGATGGGCAACTTTGCAAAATTCATCAACCATAGTTGCACCCCTAACCTTTATG
CACAAAATGTCCTATATGATCATGACGACAAGAGTGTACCTCACATTATGTTCTTTGCCT
GTGAGGACATTCCACCCCGCCAAGAACTTTCATACCACTACAACTATACAATAGATCAGG
TTCATGATGCCAATGGTAACATCAAGAAGAAAAAATGTCTCTGTGGCTCTATAGAGTGTG
ATGGTTGGTTGTATTAGGCTTGAGAGTGTACTATTTCCAGAGGCATAATTGAACTTCTTT
CATTGGGCATG

CDS

2526 bp

>Os04t0544100-01 Similar to SET domain-containing protein SET104.
ATGGGGATCCCGGAGGTGGTGGTGCCGCCGAGGGCGGCCGGCCCGCGGAGGTACAAGGGG
CTCGTGCCGTGGCGCTTCCAGCCGGGCTTCGTCAGGCCGCCTCCGGTCAAGCCCCCTGCC
GCCGCCGCCGCCGTTGCCGGAGGAGGGGTCGCGGGCACGCCCGGCGGCAAGGGTCGCGGG
TTGGGGGCGTCGGGGGAAGGCGTCGGGTCCAGTGGAGGCCGGGGAGATCCTCAATCGAGG
AGATGCACCCGCAGCGCGAGCGCGAAGGGCTCTGGTGATGCGCGGAGCGTGGAGGAGGGC
GGTCCCCGTGTTGCCGGAGACGACGGCGGTTCGGGCAAATCCGGCGTCGCGGCGGAGGGC
TCCGGATTTGAGGGTTTGAGGAATGGCAGGGGCGGTGGCGTTGGAACGGCAGCTGCCGAA
GATTGTGGTTTGGAGAAGTCCAACCCCGATGGCATCGTCGGAGATGCTGATGTGCATCTT
GAGAGCGGCAGCGATGCAAGAGATGGGGAATGCGTTTCTGAGGGTTTGAAGAAGCCTTGT
GTAAATAATAGCAATGGTTCTTCTGCCGCGGATTGCGCGCCGAAGGTGAAAAAGGGAAAT
GACAGTGGCAATGGAGGTGCCGATGAGTGTAATGCTGCAGCCAAAAGTAGCAACTTAGCA
TGTCCTGGCAACAATGGCGACGAAACGAATCGTAAGGGGCGGAAGGTAGTACTTCCATGG
AGGTTCCAGGTTGGGTTCAAGCGGTCGTTCTCGAAAGCTTTCTGCTCCGATAGTGAATCT
TCAGGGCCCTCTGGTACTCAATTCTACAGAGCCCAAGACTCTTCGACACCGTGCACTCCA
GCAACAAGAAGTTCTGTCCGGTGTTATGCGAGTGCTCATTCTGGTGTTAGAGTCTCGGCC
ATGCGTGATTTCTCAGTGAAAGGTGAGAAGGAAACATCAACTCCATATAAGAAGAGCAAA
ACTGGCATGGATGGTCCTAGTCAAGGGATGCCAAAGAATGGAGTTGTcctcgctagggaa
aacattatgggatctctgcagaattttcgcttaatttacagggaccttttggatgaagaa
gaagagaagtcgacagaagcagtgattagacctgatctacaagcttacagaattttcagg
gagcggttcatcacagactgcgatgagaagaaatatattggcaatgtgcctggaatcaaa
gttggtgatatcttccacttgagggtagagctttgtgttgttggtcttcatcgcccacac
cgggtgggtgtagatcatatcaaacaggaggatgggactTGCATAGCTGTTAGCATTGTA
TCATATGCACAATCTTCCGATATTAAGAATAATTTGGATGTCTTGGTGTATTCTGGAGCA
ATGACAGCTATAGCCAATCAGAAGATAGAGGGTACCAACTTAGCACTCAAGAAGAGTATG
GACACTAACACACCAGTCCGTGTTATCCATGGTTTCGTCACTCACCTCAATGGAAACTGC
CAGCGAAAGAAGATCCCTACTTATATATATGGGGGTTTATATATAGTCGAGAAATACTGG
AGGGAGAAAGAGGGTAATGATCGTTATGTTTATATGTTCCGACTGAGAAGAATGGCAGGT
CAGAAACACATTGACATCCAAGACATTCTGAATTCAGGACAAGCTGAATCATATGGTGGT
ATTATCATAAAAGATATATCCCGAGGATTGGAGAAGATCCCTGTATCTGTTGTTAATTCA
ATATCTGATGAGTACCCAATGCCCTATCGCTACATTGCACACCTGCAGTACCCCCGTAAC
TACCAGCCAGCACCTCCAGCAGGCTGTGGTTGTGTTGGTGGATGCTCAGATTCTAAAAGG
TGTGCATGTGCAGTGAAAAATGGTGGGGAGATTCCTTTCAATGATAAAGGCCGCATCTTA
GAAGCAAAACCTCTTGTTTATGAGTGTGGACCTTCATGCAAGTGCCCTCCTACATGTCAT
AACAGAGTTGGTCAACATGGCCTTAGGTTTCGTTTGCAAGTCTTCAAAACCAAATTGATG
GGCTGGGGAGTAAGAACTCTTGACTTCATACCATCTGGAAGCTTTGTATGTGAATACATT
GGAGAAGTGTTGGAGGATGAAGAGGCACAGAAAAGGTCGACCGATGAATACTTATTCGCT
ATTGGTCATAATTATTATGATGAAGCCCTTTGGGAGGGCCTATCAAGATCCATACCCTCA
CTTCAGAAGGGTCCTGATAAAGATGAGGAAGCTGGCTTTGCTGTTGATGCTTCAAAGATG
GGCAACTTTGCAAAATTCATCAACCATAGTTGCACCCCTAACCTTTATGCACAAAATGTC
CTATATGATCATGACGACAAGAGTGTACCTCACATTATGTTCTTTGCCTGTGAGGACATT
CCACCCCGCCAAGAACTTTCATACCACTACAACTATACAATAGATCAGGTTCATGATGCC
AATGGTAACATCAAGAAGAAAAAATGTCTCTGTGGCTCTATAGAGTGTGATGGTTGGTTG
TATTAG

Protein

842 aa

>Os04t0544100-01 Similar to SET domain-containing protein SET104.
MGIPEVVVPPRAAGPRRYKGLVPWRFQPGFVRPPPVKPPAAAAAVAGGGVAGTPGGKGRG
LGASGEGVGSSGGRGDPQSRRCTRSASAKGSGDARSVEEGGPRVAGDDGGSGKSGVAAEG
SGFEGLRNGRGGGVGTAAAEDCGLEKSNPDGIVGDADVHLESGSDARDGECVSEGLKKPC
VNNSNGSSAADCAPKVKKGNDSGNGGADECNAAAKSSNLACPGNNGDETNRKGRKVVLPW
RFQVGFKRSFSKAFCSDSESSGPSGTQFYRAQDSSTPCTPATRSSVRCYASAHSGVRVSA
MRDFSVKGEKETSTPYKKSKTGMDGPSQGMPKNGVVLARENIMGSLQNFRLIYRDLLDEE
EEKSTEAVIRPDLQAYRIFRERFITDCDEKKYIGNVPGIKVGDIFHLRVELCVVGLHRPH
RVGVDHIKQEDGTCIAVSIVSYAQSSDIKNNLDVLVYSGAMTAIANQKIEGTNLALKKSM
DTNTPVRVIHGFVTHLNGNCQRKKIPTYIYGGLYIVEKYWREKEGNDRYVYMFRLRRMAG
QKHIDIQDILNSGQAESYGGIIIKDISRGLEKIPVSVVNSISDEYPMPYRYIAHLQYPRN
YQPAPPAGCGCVGGCSDSKRCACAVKNGGEIPFNDKGRILEAKPLVYECGPSCKCPPTCH
NRVGQHGLRFRLQVFKTKLMGWGVRTLDFIPSGSFVCEYIGEVLEDEEAQKRSTDEYLFA
IGHNYYDEALWEGLSRSIPSLQKGPDKDEEAGFAVDASKMGNFAKFINHSCTPNLYAQNV
LYDHDDKSVPHIMFFACEDIPPRQELSYHYNYTIDQVHDANGNIKKKKCLCGSIECDGWL
Y*

5'UTR

chr04:27246662..27246792 (- strand) : 131 bp

CDS

chr04:27244136..27246661 (- strand) : 2526 bp

3'UTR

chr04:27244082..27244135 (- strand) : 54 bp

FASTA

>Os04t0544100-01 class=Sequence position=chr04:27244082..27246792 (- strand)
AGGAGAACCC CCACCCCACC CACCTCGCCC CACTCCGCCG CGCCCCCTCC CCGCTGCCTC CGTGGAGCGT CATCTCCGCG
TGCAGGGTTA GAGGCTTCTG GTGGTGGTGG GGGCAGTGCG GGGGGCGTTG GATGGGGATC CCGGAGGTGG TGGTGCCGCC
GAGGGCGGCC GGCCCGCGGA GGTACAAGGG GCTCGTGCCG TGGCGCTTCC AGCCGGGCTT CGTCAGGCCG CCTCCGGTCA
AGCCCCCTGC CGCCGCCGCC GCCGTTGCCG GAGGAGGGGT CGCGGGCACG CCCGGCGGCA AGGGTCGCGG GTTGGGGGCG
TCGGGGGAAG GCGTCGGGTC CAGTGGAGGC CGGGGAGATC CTCAATCGAG GAGATGCACC CGCAGCGCGA GCGCGAAGGG
CTCTGGTGAT GCGCGGAGCG TGGAGGAGGG CGGTCCCCGT GTTGCCGGAG ACGACGGCGG TTCGGGCAAA TCCGGCGTCG
CGGCGGAGGG CTCCGGATTT GAGGGTTTGA GGAATGGCAG GGGCGGTGGC GTTGGAACGG CAGCTGCCGA AGATTGTGGT
TTGGAGAAGT CCAACCCCGA TGGCATCGTC GGAGATGCTG ATGTGCATCT TGAGAGCGGC AGCGATGCAA GAGATGGGGA
ATGCGTTTCT GAGGGTTTGA AGAAGCCTTG TGTAAATAAT AGCAATGGTT CTTCTGCCGC GGATTGCGCG CCGAAGGTGA
AAAAGGGAAA TGACAGTGGC AATGGAGGTG CCGATGAGTG TAATGCTGCA GCCAAAAGTA GCAACTTAGC ATGTCCTGGC
AACAATGGCG ACGAAACGAA TCGTAAGGGG CGGAAGGTAG TACTTCCATG GAGGTTCCAG GTTGGGTTCA AGCGGTCGTT
CTCGAAAGCT TTCTGCTCCG ATAGTGAATC TTCAGGGCCC TCTGGTACTC AATTCTACAG AGCCCAAGAC TCTTCGACAC
CGTGCACTCC AGCAACAAGA AGTTCTGTCC GGTGTTATGC GAGTGCTCAT TCTGGTGTTA GAGTCTCGGC CATGCGTGAT
TTCTCAGTGA AAGGTGAGAA GGAAACATCA ACTCCATATA AGAAGAGCAA AACTGGCATG GATGGTCCTA GTCAAGGGAT
GCCAAAGAAT GGAGTTGTcc tcgctaggga aaacattatg ggatctctgc agaattttcg cttaatttac agggaccttt
tggatgaaga agaagagaag tcgacagaag cagtgattag acctgatcta caagcttaca gaattttcag ggagcggttc
atcacagact gcgatgagaa gaaatatatt ggcaatgtgc ctggaatcaa agttggtgat atcttccact tgagggtaga
gctttgtgtt gttggtcttc atcgcccaca ccgggtgggt gtagatcata tcaaacagga ggatgggact TGCATAGCTG
TTAGCATTGT ATCATATGCA CAATCTTCCG ATATTAAGAA TAATTTGGAT GTCTTGGTGT ATTCTGGAGC AATGACAGCT
ATAGCCAATC AGAAGATAGA GGGTACCAAC TTAGCACTCA AGAAGAGTAT GGACACTAAC ACACCAGTCC GTGTTATCCA
TGGTTTCGTC ACTCACCTCA ATGGAAACTG CCAGCGAAAG AAGATCCCTA CTTATATATA TGGGGGTTTA TATATAGTCG
AGAAATACTG GAGGGAGAAA GAGGGTAATG ATCGTTATGT TTATATGTTC CGACTGAGAA GAATGGCAGG TCAGAAACAC
ATTGACATCC AAGACATTCT GAATTCAGGA CAAGCTGAAT CATATGGTGG TATTATCATA AAAGATATAT CCCGAGGATT
GGAGAAGATC CCTGTATCTG TTGTTAATTC AATATCTGAT GAGTACCCAA TGCCCTATCG CTACATTGCA CACCTGCAGT
ACCCCCGTAA CTACCAGCCA GCACCTCCAG CAGGCTGTGG TTGTGTTGGT GGATGCTCAG ATTCTAAAAG GTGTGCATGT
GCAGTGAAAA ATGGTGGGGA GATTCCTTTC AATGATAAAG GCCGCATCTT AGAAGCAAAA CCTCTTGTTT ATGAGTGTGG
ACCTTCATGC AAGTGCCCTC CTACATGTCA TAACAGAGTT GGTCAACATG GCCTTAGGTT TCGTTTGCAA GTCTTCAAAA
CCAAATTGAT GGGCTGGGGA GTAAGAACTC TTGACTTCAT ACCATCTGGA AGCTTTGTAT GTGAATACAT TGGAGAAGTG
TTGGAGGATG AAGAGGCACA GAAAAGGTCG ACCGATGAAT ACTTATTCGC TATTGGTCAT AATTATTATG ATGAAGCCCT
TTGGGAGGGC CTATCAAGAT CCATACCCTC ACTTCAGAAG GGTCCTGATA AAGATGAGGA AGCTGGCTTT GCTGTTGATG
CTTCAAAGAT GGGCAACTTT GCAAAATTCA TCAACCATAG TTGCACCCCT AACCTTTATG CACAAAATGT CCTATATGAT
CATGACGACA AGAGTGTACC TCACATTATG TTCTTTGCCT GTGAGGACAT TCCACCCCGC CAAGAACTTT CATACCACTA
CAACTATACA ATAGATCAGG TTCATGATGC CAATGGTAAC ATCAAGAAGA AAAAATGTCT CTGTGGCTCT ATAGAGTGTG
ATGGTTGGTT GTATTAGGCT TGAGAGTGTA CTATTTCCAG AGGCATAATT GAACTTCTTT CATTGGGCAT G

Locus: Os04g0544100

Loading...

Locus: Os04g0544100

Loading...