Os04t0549600-01

Locus

Os04g0549600

Description

Chaperone DnaJ protein, Negative regulation of rice innate immunity, Basal resistance to Magnaporthe oryzae

RAP-DB Gene Symbol Synonym(s)

OsDjA6

RAP-DB Gene Name Synonym(s)

DnaJ domain protein A6

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjA6, DjA6

Oryzabase Gene Name Synonym(s)

DnaJ domain protein A6, DnaJ protein RNB8

Transcript Evidence

AK101956

Protein Evidence

Q0JB88

Literature

PMID: 28220688

Note

Manual Curation

April 20, 2017

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Biological Process: response to heat (GO:0009408)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Chaperone DnaJ (IPR012724)

DnaJ domain (IPR001623)

HSP40/DnaJ peptide-binding (IPR008971)

Chaperone DnaJ, C-terminal (IPR002939)

Heat shock protein DnaJ, cysteine-rich domain (IPR001305)

DnaJ domain, conserved site (IPR018253)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

cytoplasm (GO:0005737)

Full-length cDNA

J033075M11 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0549600-01)

RiceXPro (AK101956)

Others

Oryzabase (12143)

KEGG (Os04t0549600-01)

Transcript

1630 bp

>Os04t0549600-01 Chaperone DnaJ protein, Negative regulation of rice innate immunity, Basal resistance to Magnaporthe oryzae
GGTCGCGTGGCTTGAGCGGTGGTGACACCGCTCGCCTCCGTCCGCCTCGCCTCCACCGAG
AGGTTCTCTCTGCCGCCGATTCAGATTTACAGGGAGATTATCTTGTGATCTGTAAACATG
TTTGGGCGTGTACCGAGGAGTAACAACACCAAGTACTATGAGGTTCTTGGAGTTCCTAAA
ACTGCAAGCAAGGATGAGCTAAAGAAGGCATACCGGAAGGCTGCCATAAAAAACCATCCT
GACAAGGGAGGGGATCCAGAAAAGTTTAAAGAATTATCACAAGCGTATGAGGTTCTCACT
GATCCTGAGAAGAGAGACATATATGACCAATATGGGGAGGATGCTCTTAAGGATGGAATG
GGAGGAGGCAGTGACTTCCATAATCCATTTGACATATTTGAGCAGTTTTTCGGGGGTGGT
GCCTTTGGGGGGAGTAGCTCAAGAGTACGCAGACAGAGACGTGGTGAAGATGTGGCGCAT
ACTTTGAAGGTGTCTTTAGAAGATGTGTATAATGGATCTATGAAGAAACTATCATTATCA
CGAAATATTCTGTGCCCAAAGTGCAAAGGAAAAGGGACCAAATCTGAGGCTCCAGCAACA
TGCTATGGTTGTCATGGTGTAGGAATGAGGAATATAATGCGACAGATAGGACTAGGCATG
ATTCAACATATGCAGACTGTCTGTCCTGAATGCAGAGGATCAGGTGAGATCATAAGTGAC
AGGGATAAATGCACAAACTGCAGAGCTAGCAAAGTTATTCAGGAGAAAAAGGTGCTTGAG
GTTCATATTGAGAAGGGAATGCAACATGGCCAAAAAATTGTATTCCAAGGTGAAGCTGAT
GAAGCTCCTGATACAGTGACAGGAGATATAGTATTTATCTTGCAAGTTAAGGTACATCCA
AGATTTAAGAGGAAATATGATGACCTGTTCATTGAGCGCACAATCTCTTTAACTGAGGCA
TTGTGTGGGTTCCAATTCATCCTCACTCATCTGGACAGTAGGCAGCTCCTAATCAAGGCA
AATCCTGGCGAAATTATTAAACCTGGTCAACACAAGGCCATAAATGATGAGGGAATGCCA
CACCATGGCCGGCCTTTCATGAAGGGCCGTCTCTTTGTGGAATTCAATGTTGAGTTCCCT
GAATCTGGTGTACTCTCCCGTGACCAATGCCGGGCACTTGAGATGATCCTACCACCTAAA
CCTGGGCACCAATTATCAGATATGGACCTGGATCAATGTGAGGAAACTACCATGCATGAT
GTGAACATAGAAGAGGAGATGAGGCGCAAGCAGTATCAAAGGAAGCAGGAAGCGTACGAC
GAAGATGAGGAGGAGGATGCTCCAAGAGTACAGTGTGCTCAACAGTAAGAAGTGTCACTT
TCTGGCGCAAGTGATGATACTCCATGTAAACTAAGTAGTTTTTGGTGAGACTGTTCATTT
TAGTGTATTTTGTACTAGTTAAATTAAATAGTGAATGTCTAAGTTGTGTCGTTTGATATA
TAAGCTTGTGCTAACAACATAAGGCTTTCTTGGCCTTCATAAGATATACTCCTACCTAGG
AGAAAGTGGTGGATGAGCATTCGTTTCTGTTTTTATTGGTAATGAACATATTTACATGTT
GTATTGACTG

CDS

1251 bp

>Os04t0549600-01 Chaperone DnaJ protein, Negative regulation of rice innate immunity, Basal resistance to Magnaporthe oryzae
ATGTTTGGGCGTGTACCGAGGAGTAACAACACCAAGTACTATGAGGTTCTTGGAGTTCCT
AAAACTGCAAGCAAGGATGAGCTAAAGAAGGCATACCGGAAGGCTGCCATAAAAAACCAT
CCTGACAAGGGAGGGGATCCAGAAAAGTTTAAAGAATTATCACAAGCGTATGAGGTTCTC
ACTGATCCTGAGAAGAGAGACATATATGACCAATATGGGGAGGATGCTCTTAAGGATGGA
ATGGGAGGAGGCAGTGACTTCCATAATCCATTTGACATATTTGAGCAGTTTTTCGGGGGT
GGTGCCTTTGGGGGGAGTAGCTCAAGAGTACGCAGACAGAGACGTGGTGAAGATGTGGCG
CATACTTTGAAGGTGTCTTTAGAAGATGTGTATAATGGATCTATGAAGAAACTATCATTA
TCACGAAATATTCTGTGCCCAAAGTGCAAAGGAAAAGGGACCAAATCTGAGGCTCCAGCA
ACATGCTATGGTTGTCATGGTGTAGGAATGAGGAATATAATGCGACAGATAGGACTAGGC
ATGATTCAACATATGCAGACTGTCTGTCCTGAATGCAGAGGATCAGGTGAGATCATAAGT
GACAGGGATAAATGCACAAACTGCAGAGCTAGCAAAGTTATTCAGGAGAAAAAGGTGCTT
GAGGTTCATATTGAGAAGGGAATGCAACATGGCCAAAAAATTGTATTCCAAGGTGAAGCT
GATGAAGCTCCTGATACAGTGACAGGAGATATAGTATTTATCTTGCAAGTTAAGGTACAT
CCAAGATTTAAGAGGAAATATGATGACCTGTTCATTGAGCGCACAATCTCTTTAACTGAG
GCATTGTGTGGGTTCCAATTCATCCTCACTCATCTGGACAGTAGGCAGCTCCTAATCAAG
GCAAATCCTGGCGAAATTATTAAACCTGGTCAACACAAGGCCATAAATGATGAGGGAATG
CCACACCATGGCCGGCCTTTCATGAAGGGCCGTCTCTTTGTGGAATTCAATGTTGAGTTC
CCTGAATCTGGTGTACTCTCCCGTGACCAATGCCGGGCACTTGAGATGATCCTACCACCT
AAACCTGGGCACCAATTATCAGATATGGACCTGGATCAATGTGAGGAAACTACCATGCAT
GATGTGAACATAGAAGAGGAGATGAGGCGCAAGCAGTATCAAAGGAAGCAGGAAGCGTAC
GACGAAGATGAGGAGGAGGATGCTCCAAGAGTACAGTGTGCTCAACAGTAA

Protein

417 aa

>Os04t0549600-01 Chaperone DnaJ protein, Negative regulation of rice innate immunity, Basal resistance to Magnaporthe oryzae
MFGRVPRSNNTKYYEVLGVPKTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEVL
TDPEKRDIYDQYGEDALKDGMGGGSDFHNPFDIFEQFFGGGAFGGSSSRVRRQRRGEDVA
HTLKVSLEDVYNGSMKKLSLSRNILCPKCKGKGTKSEAPATCYGCHGVGMRNIMRQIGLG
MIQHMQTVCPECRGSGEIISDRDKCTNCRASKVIQEKKVLEVHIEKGMQHGQKIVFQGEA
DEAPDTVTGDIVFILQVKVHPRFKRKYDDLFIERTISLTEALCGFQFILTHLDSRQLLIK
ANPGEIIKPGQHKAINDEGMPHHGRPFMKGRLFVEFNVEFPESGVLSRDQCRALEMILPP
KPGHQLSDMDLDQCEETTMHDVNIEEEMRRKQYQRKQEAYDEDEEEDAPRVQCAQQ*

5'UTR

chr04:27505498..27505581 (+ strand) : 84 bp

chr04:27506407..27506439 (+ strand) : 33 bp

CDS

chr04:27506440..27506586 (+ strand) : 147 bp

chr04:27506667..27506832 (+ strand) : 166 bp

chr04:27506943..27507081 (+ strand) : 139 bp

chr04:27508576..27508709 (+ strand) : 134 bp

chr04:27508809..27508951 (+ strand) : 143 bp

chr04:27509089..27509287 (+ strand) : 199 bp

chr04:27509410..27509732 (+ strand) : 323 bp

3'UTR

chr04:27509733..27509994 (+ strand) : 262 bp

FASTA

>Os04t0549600-01 class=Sequence position=chr04:27505498..27509994 (+ strand)
GGTCGCGTGG CTTGAGCGGT GGTGACACCG CTCGCCTCCG TCCGCCTCGC CTCCACCGAG AGGTTCTCTC TGCCGCCGAT
TCAGGTACGA TCGCTTCACT ACGCCCCAAT CTTTCATGGC CGAGACTCTC CTAAGGACCG GTTGGATCGC GTATGAGCCC
CCCGTGATTT TTCTGGAGGG GGGAAACCGA GTGTATTTTT TGCTTGTTCT GCGCCGTTTT CTTGGCTGTT CTACCGATCT
TGTTGGTTGG ATTCTTCGGA GGAGAGGTGG AGCCTTGTCC TGATTTGGAG GGGAGGCGAA GTTTTCCAGG GTTGTGTAGG
ACACCTCGTG GGGGTTCGCG GTGGCTGGAG AAATATTCGT GATCAGCTCT CCTTAGGGGA TTTTTTTTTT TACCTTAGTT
GTCTGCTCCG CTCGAAACAC AGAGTTCGGT GGGGATGAGA CTAGATTTTC CTTCGATTTT CCGGATGTTT TTGAGTTGGG
TGCCAAATAT GTTAAAAGTT CAATGTGGTC AGGCACTTGC GCATGTGGTG GAGTCGTCCT TCTACGATTT TTTGTTGGTT
TTATATTTGT TGTAAATGCG TAAAATTAGC TCCCATTTTA GTTTGTTTAA CAGAACTGAT TACATTTTAT ATTACTAGCA
TATTACTGAT CGTTGAGTAC GGAGTATATA TATTAAAATT ACAGTGATCC TTGGCCTTTT TACTCTCTGT TTGGCATTTC
GGTGGCTGTT CAAAAGCCAT AGTTTATTTC GATGTTTGAT TAAAAATTGT TACTATAAGC ATTTTAATTA TAGTTGTAAC
AGGGAAACAA AGTCATACTA GGATTAGTAA AATTCCCCTA TTTTGAGTAG ACTCCAATGC ACAATATGTC ACCGACTCAA
CCACTGCAGA CTGACCCTTA GTTCTACAGA TTTACAGGGA GATTATCTTG TGATCTGTAA ACATGTTTGG GCGTGTACCG
AGGAGTAACA ACACCAAGTA CTATGAGGTT CTTGGAGTTC CTAAAACTGC AAGCAAGGAT GAGCTAAAGA AGGCATACCG
GAAGGCTGCC ATAAAAAACC ATCCTGACAA GGGAGGGGAT CCAGAAAAGG TGAGGATGTG CCAGTGTGAC ATGCAATTGT
TTGAATTCAG AATCTCTATT TTGTTTTTAC ATTTTTATGT GTTTTACAGT TTAAAGAATT ATCACAAGCG TATGAGGTTC
TCACTGATCC TGAGAAGAGA GACATATATG ACCAATATGG GGAGGATGCT CTTAAGGATG GAATGGGAGG AGGCAGTGAC
TTCCATAATC CATTTGACAT ATTTGAGCAG TTTTTCGGGG GTGGTGCCTT TGGGGGTAAG CAACATATGT ACCCTGAAAT
TTTCCAGCAC CCTCAACATT TTTTTGTTTG AACTTTTTTT TTAAAAAAAA ACAGAATTAT TCATGCTAAC TTTTATGGTT
AACAGGGAGT AGCTCAAGAG TACGCAGACA GAGACGTGGT GAAGATGTGG CGCATACTTT GAAGGTGTCT TTAGAAGATG
TGTATAATGG ATCTATGAAG AAACTATCAT TATCACGAAA TATTCTGTGC CCAAAGTGCA AAGGGTAAGC CTTTGTATGT
TATTGCTGCA CTTCAATTTG CTAACTGGAG GAAATGATGT ACTCATTATT TGGCAAAATT ATTACTTATC ATGCTCTTTC
ACTTTAGCAT TATCGATACA TATGATTCCA TCTAGTTGAA AATAAGGTGT AAATAGTTAT CCCGAAGTGT TCACTGTAAT
TTCTCTATAT TGCTAGTTTA AATCCATCAA CTGGTGATTG TATTTGTTTT GTATTTTCGT GCGCACTTAT TTCTATTATT
TTTGCATGTA CTTGAGATGC AGGGAAACCC AGTTAAATGT TTCGGTTACT GGATAATCCC TTAACATTAT CCCATTCCAT
TTATGTTCTG TTTCAACCTA TCCATAAAAA AAATCATTAA TGAGAGACCT AATGCTAACG GATACATGCT TGTGTCAGCC
AACAATGTTA GAAGATATCC TTACATTTAT CCACACTGCT TCTATTCTTG AATCTTTTAT TGAATTAAAA AAAGGTGCAA
ACGTAATTTT ATAGAACCTG AACCATCCCC AAAAGTCCAA AACTAGTTTA ATAAGGGTAT CTTGCACATT TGGGGAATAT
GTTGGACTCC ATGCTAAAGC CAATGTTTAT TATAGTCCTA CATATCTATA CTCCTCTAAA AGACCCCAAT GGTGGTGGTG
AGTATTGAAT TTGCCACCAC CCACCACCAC TGCATGTGGG TCCCCCAAAT AGTGAGGTAG GTGGACTTTT GCCCCTTCCC
CAACCTCAAG CCATCAAACA GAAAATTTTT CTTTTGAAGT GAGGTAAAAA TGATGACAAA TAATATGACT AGAAGATTTT
ACAATGAGAA TAATTTTATT AATTTTTGAG GCTGTAAAGT GTATGGAGGA GTTCTCTTCA TGTTGCAATG CAGGGGCATT
CAGATAGTAT AATTATAGAA TAACATATGT AGTATGTAAA TCCTGATTAA GATGGCTGTG AATTGGCCTA TATAATGCCA
AGCTTGCAAT ACCGACTACC GAATACCTAG TCTAATTTTG ACTGCCTCTG TAAATACGAC ATCTAATGTG CAATGAAAGC
TAACCTCCCA TTTTATAAAG AAATAGACAG TGCACCCAAT CAAATAGACA GTGCCTATTG AAATGCTTCA TCCCAGTAAA
GCTTTAAAAA TAAGTCCAGC CCAGTTAAAA CACATTACAC AGATCAAATA CATCTATATG GCCGATTTCA ACCCAGGTTT
ATTCACCATT CTGAGGCGTA GCTAGCTCTA TCACCATAAT TAGTTTAGTT TATCATTCAA AATATATACG AGGCAAAATT
CATGTTTTTT TTGTGGCCCA TTTCAATCCA GGTTTATTCA CCATTCTGAG GGGCCCTGTA AAATTCCTTC TATAAATATA
GAAGAGGCAA AGGTTTTGCC CTTCATTCAA AAAAATAATT AGTTTATCAT GTTTTTTTTA TCTGTTTTGA GTGTTGACTG
TAGTGTTTCA CCTTTTCCAT CTTACTCTCT GCTTTCAGAA AAGGGACCAA ATCTGAGGCT CCAGCAACAT GCTATGGTTG
TCATGGTGTA GGAATGAGGA ATATAATGCG ACAGATAGGA CTAGGCATGA TTCAACATAT GCAGACTGTC TGTCCTGAAT
GCAGAGGATC AGGTATGCAA CAGTTGCTCC AATTTTTATG CTATATCTTG CTGCAAAATT GTGATTTCTT AGGAGCCTGC
TTTATGTTTG TAATGTTCTA TACTTGATCA GGTGAGATCA TAAGTGACAG GGATAAATGC ACAAACTGCA GAGCTAGCAA
AGTTATTCAG GAGAAAAAGG TGCTTGAGGT TCATATTGAG AAGGGAATGC AACATGGCCA AAAAATTGTA TTCCAAGGTG
AAGCTGATGA AGCTGTAAGT TTATTTTGTC CATTTATACT AGTATACATA CTTGCAGCCA CATATTCATC CATCCTTGTG
CTAATGAATA TCTGTGCATG CACTACTTTC TTTATCTAAT ATTTTGCACT GTGTGTTTCA TGCTGTTGCA GCCTGATACA
GTGACAGGAG ATATAGTATT TATCTTGCAA GTTAAGGTAC ATCCAAGATT TAAGAGGAAA TATGATGACC TGTTCATTGA
GCGCACAATC TCTTTAACTG AGGCATTGTG TGGGTTCCAA TTCATCCTCA CTCATCTGGA CAGTAGGCAG CTCCTAATCA
AGGCAAATCC TGGCGAAATT ATTAAACCTG GTATCTCATC CCCTTAAAAT GCTAGCCTTT TTGTTTGCCA CTTCGTAATT
CTGTTTTTTC TATTCAGATT CTAATCAGTT GCAGACTTTT TTAAAGAATT AACTCAAATA TTTTCCAAAC AGGTCAACAC
AAGGCCATAA ATGATGAGGG AATGCCACAC CATGGCCGGC CTTTCATGAA GGGCCGTCTC TTTGTGGAAT TCAATGTTGA
GTTCCCTGAA TCTGGTGTAC TCTCCCGTGA CCAATGCCGG GCACTTGAGA TGATCCTACC ACCTAAACCT GGGCACCAAT
TATCAGATAT GGACCTGGAT CAATGTGAGG AAACTACCAT GCATGATGTG AACATAGAAG AGGAGATGAG GCGCAAGCAG
TATCAAAGGA AGCAGGAAGC GTACGACGAA GATGAGGAGG AGGATGCTCC AAGAGTACAG TGTGCTCAAC AGTAAGAAGT
GTCACTTTCT GGCGCAAGTG ATGATACTCC ATGTAAACTA AGTAGTTTTT GGTGAGACTG TTCATTTTAG TGTATTTTGT
ACTAGTTAAA TTAAATAGTG AATGTCTAAG TTGTGTCGTT TGATATATAA GCTTGTGCTA ACAACATAAG GCTTTCTTGG
CCTTCATAAG ATATACTCCT ACCTAGGAGA AAGTGGTGGA TGAGCATTCG TTTCTGTTTT TATTGGTAAT GAACATATTT
ACATGTTGTA TTGACTG

Locus: Os04g0549600

Loading...

Locus: Os04g0549600

Loading...