Os04t0549600-02

Locus

Os04g0549600

Description

Similar to OSIGBa0134H18.3 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjA6, DjA6

Oryzabase Gene Name Synonym(s)

DnaJ domain protein A6, DnaJ protein RNB8

Transcript Evidence

AK061922 (DDBJ, Best hit)

Protein Evidence

B0FFN7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, cysteine-rich domain (IPR001305)

Heat shock protein DnaJ, N-terminal (IPR001623)

Chaperone DnaJ, C-terminal (IPR002939)

Heat shock protein DnaJ (IPR003095)

HSP40/DnaJ peptide-binding (IPR008971)

Heat shock protein DnaJ, conserved site (IPR018253)

Full-length cDNA

001-042-B10 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0549600-02)

RiceXPro (AK061922)

Others

Oryzabase (12143)

KEGG (Os04t0549600-02)

Transcript

1401 bp

>Os04t0549600-02 Similar to OSIGBa0134H18.3 protein.
AAAACTGCAAGCAAGGATGAGCTAAAGAAGGCATACCGGAAGGCTGCCATAAAAAACCAT
CCTGACAAGGGAGGGGATCCAGAAAAGTTTAAAGAATTATCACAAGCGTATGAGGTTCTC
ACTGATCCTGAGAAGAGAGACATATATGACCAATATGGGGAGGATGCTCTTAAGGATGGA
ATGGGAGGAGGCAGTGACTTCCATAATCCATTTGACATATTTGAGCAGTTTTTCGGGGGT
GGTGCCTTTGGGGGGAGTAGCTCAAGAGTACGCAGACAGAGACGTGGTGAAGATGTGGCG
CATACTTTGAAGGTGTCTTTAGAAGATGTGTATAATGGATCTATGAAGAAACTATCATTA
TCACGAAATATTCTGTGCCCAAAGTGCAAAGGAAAAGGGACCAAATCTGAGGCTCCAGCA
ACATGCTATGGTTGTCATGGTGTAGGAATGAGGAATATAATGCGACAGATAGGACTAGGC
ATGATTCAACATATGCAGACTGTCTGTCCTGAATGCAGAGGATCAGGTGAGATCATAAGT
GACAGGGATAAATGCACAAACTGCAGAGCTAGCAAAGTTATTCAGGAGAAAAAGGTGCTT
GAGGTTCATATTGAGAAGGGAATGCAACATGGCCAAAAAATTGTATTCCAAGGTGAAGCT
GATGAAGCTCCTGATACAGTGACAGGAGATATAGTATTTATCTTGCAAGTTAAGGTACAT
CCAAGATTTAAGAGGAAATATGATGACCTGTTCATTGAGCGCACAATCTCTTTAACTGAG
GCATTGTGTGGGTTCCAATTCATCCTCACTCATCTGGACAGTAGGCAGCTCCTAATCAAG
GCAAATCCTGGCGAAATTATTAAACCTGGTCAACACAAGGCCATAAATGATGAGGGAATG
CCACACCATGGCCGGCCTTTCATGAAGGGCCGTCTCTTTGTGGAATTCAATGTTGAGTTC
CCTGAATCTGGTGTACTCTCCCGTGACCAATGCCGGGCACTTGAGATGATCCTACCACCT
AAACCTGGGCACCAATTATCAGATATGGACCTGGATCAATGTGAGGAAACTACCATGCAT
GATGTGAACATAGAAGAGGAGATGAGGCGCAAGCAGTATCAAAGGAAGCAGGAAGCGTAC
GACGAAGATGAGGAGGAGGATGCTCCAAGAGTACAGTGTGCTCAACAGTAAGAAGTGTCA
CTTTCTGGCGCAAGTGATGATACTCCATGTAAACTAAGTAGTTTTTGGTGAGACTGTTCA
TTTTAGTGTATTTTGTACTAGTTAAATTAAATAGTGAATGTCTAAGTTGTGTCGTTTGAT
ATATAAGCTTGTGCTAACAACATAAGGCTTTCTTGGCCTTCATAAGATATACTCCTACCT
AGGAGAAAGTGGTGGATGAGC

CDS

1191 bp

>Os04t0549600-02 Similar to OSIGBa0134H18.3 protein.
AAAACTGCAAGCAAGGATGAGCTAAAGAAGGCATACCGGAAGGCTGCCATAAAAAACCAT
CCTGACAAGGGAGGGGATCCAGAAAAGTTTAAAGAATTATCACAAGCGTATGAGGTTCTC
ACTGATCCTGAGAAGAGAGACATATATGACCAATATGGGGAGGATGCTCTTAAGGATGGA
ATGGGAGGAGGCAGTGACTTCCATAATCCATTTGACATATTTGAGCAGTTTTTCGGGGGT
GGTGCCTTTGGGGGGAGTAGCTCAAGAGTACGCAGACAGAGACGTGGTGAAGATGTGGCG
CATACTTTGAAGGTGTCTTTAGAAGATGTGTATAATGGATCTATGAAGAAACTATCATTA
TCACGAAATATTCTGTGCCCAAAGTGCAAAGGAAAAGGGACCAAATCTGAGGCTCCAGCA
ACATGCTATGGTTGTCATGGTGTAGGAATGAGGAATATAATGCGACAGATAGGACTAGGC
ATGATTCAACATATGCAGACTGTCTGTCCTGAATGCAGAGGATCAGGTGAGATCATAAGT
GACAGGGATAAATGCACAAACTGCAGAGCTAGCAAAGTTATTCAGGAGAAAAAGGTGCTT
GAGGTTCATATTGAGAAGGGAATGCAACATGGCCAAAAAATTGTATTCCAAGGTGAAGCT
GATGAAGCTCCTGATACAGTGACAGGAGATATAGTATTTATCTTGCAAGTTAAGGTACAT
CCAAGATTTAAGAGGAAATATGATGACCTGTTCATTGAGCGCACAATCTCTTTAACTGAG
GCATTGTGTGGGTTCCAATTCATCCTCACTCATCTGGACAGTAGGCAGCTCCTAATCAAG
GCAAATCCTGGCGAAATTATTAAACCTGGTCAACACAAGGCCATAAATGATGAGGGAATG
CCACACCATGGCCGGCCTTTCATGAAGGGCCGTCTCTTTGTGGAATTCAATGTTGAGTTC
CCTGAATCTGGTGTACTCTCCCGTGACCAATGCCGGGCACTTGAGATGATCCTACCACCT
AAACCTGGGCACCAATTATCAGATATGGACCTGGATCAATGTGAGGAAACTACCATGCAT
GATGTGAACATAGAAGAGGAGATGAGGCGCAAGCAGTATCAAAGGAAGCAGGAAGCGTAC
GACGAAGATGAGGAGGAGGATGCTCCAAGAGTACAGTGTGCTCAACAGTAA

Protein

397 aa

>Os04t0549600-02 Similar to OSIGBa0134H18.3 protein.
KTASKDELKKAYRKAAIKNHPDKGGDPEKFKELSQAYEVLTDPEKRDIYDQYGEDALKDG
MGGGSDFHNPFDIFEQFFGGGAFGGSSSRVRRQRRGEDVAHTLKVSLEDVYNGSMKKLSL
SRNILCPKCKGKGTKSEAPATCYGCHGVGMRNIMRQIGLGMIQHMQTVCPECRGSGEIIS
DRDKCTNCRASKVIQEKKVLEVHIEKGMQHGQKIVFQGEADEAPDTVTGDIVFILQVKVH
PRFKRKYDDLFIERTISLTEALCGFQFILTHLDSRQLLIKANPGEIIKPGQHKAINDEGM
PHHGRPFMKGRLFVEFNVEFPESGVLSRDQCRALEMILPPKPGHQLSDMDLDQCEETTMH
DVNIEEEMRRKQYQRKQEAYDEDEEEDAPRVQCAQQ*

CDS

chr04:27506500..27506586 (+ strand) : 87 bp

chr04:27506667..27506832 (+ strand) : 166 bp

chr04:27506943..27507081 (+ strand) : 139 bp

chr04:27508576..27508709 (+ strand) : 134 bp

chr04:27508809..27508951 (+ strand) : 143 bp

chr04:27509089..27509287 (+ strand) : 199 bp

chr04:27509410..27509732 (+ strand) : 323 bp

3'UTR

chr04:27509733..27509942 (+ strand) : 210 bp

FASTA

>Os04t0549600-02 class=Sequence position=chr04:27506500..27509942 (+ strand)
AAAACTGCAA GCAAGGATGA GCTAAAGAAG GCATACCGGA AGGCTGCCAT AAAAAACCAT CCTGACAAGG GAGGGGATCC
AGAAAAGGTG AGGATGTGCC AGTGTGACAT GCAATTGTTT GAATTCAGAA TCTCTATTTT GTTTTTACAT TTTTATGTGT
TTTACAGTTT AAAGAATTAT CACAAGCGTA TGAGGTTCTC ACTGATCCTG AGAAGAGAGA CATATATGAC CAATATGGGG
AGGATGCTCT TAAGGATGGA ATGGGAGGAG GCAGTGACTT CCATAATCCA TTTGACATAT TTGAGCAGTT TTTCGGGGGT
GGTGCCTTTG GGGGTAAGCA ACATATGTAC CCTGAAATTT TCCAGCACCC TCAACATTTT TTTGTTTGAA CTTTTTTTTT
AAAAAAAAAC AGAATTATTC ATGCTAACTT TTATGGTTAA CAGGGAGTAG CTCAAGAGTA CGCAGACAGA GACGTGGTGA
AGATGTGGCG CATACTTTGA AGGTGTCTTT AGAAGATGTG TATAATGGAT CTATGAAGAA ACTATCATTA TCACGAAATA
TTCTGTGCCC AAAGTGCAAA GGGTAAGCCT TTGTATGTTA TTGCTGCACT TCAATTTGCT AACTGGAGGA AATGATGTAC
TCATTATTTG GCAAAATTAT TACTTATCAT GCTCTTTCAC TTTAGCATTA TCGATACATA TGATTCCATC TAGTTGAAAA
TAAGGTGTAA ATAGTTATCC CGAAGTGTTC ACTGTAATTT CTCTATATTG CTAGTTTAAA TCCATCAACT GGTGATTGTA
TTTGTTTTGT ATTTTCGTGC GCACTTATTT CTATTATTTT TGCATGTACT TGAGATGCAG GGAAACCCAG TTAAATGTTT
CGGTTACTGG ATAATCCCTT AACATTATCC CATTCCATTT ATGTTCTGTT TCAACCTATC CATAAAAAAA ATCATTAATG
AGAGACCTAA TGCTAACGGA TACATGCTTG TGTCAGCCAA CAATGTTAGA AGATATCCTT ACATTTATCC ACACTGCTTC
TATTCTTGAA TCTTTTATTG AATTAAAAAA AGGTGCAAAC GTAATTTTAT AGAACCTGAA CCATCCCCAA AAGTCCAAAA
CTAGTTTAAT AAGGGTATCT TGCACATTTG GGGAATATGT TGGACTCCAT GCTAAAGCCA ATGTTTATTA TAGTCCTACA
TATCTATACT CCTCTAAAAG ACCCCAATGG TGGTGGTGAG TATTGAATTT GCCACCACCC ACCACCACTG CATGTGGGTC
CCCCAAATAG TGAGGTAGGT GGACTTTTGC CCCTTCCCCA ACCTCAAGCC ATCAAACAGA AAATTTTTCT TTTGAAGTGA
GGTAAAAATG ATGACAAATA ATATGACTAG AAGATTTTAC AATGAGAATA ATTTTATTAA TTTTTGAGGC TGTAAAGTGT
ATGGAGGAGT TCTCTTCATG TTGCAATGCA GGGGCATTCA GATAGTATAA TTATAGAATA ACATATGTAG TATGTAAATC
CTGATTAAGA TGGCTGTGAA TTGGCCTATA TAATGCCAAG CTTGCAATAC CGACTACCGA ATACCTAGTC TAATTTTGAC
TGCCTCTGTA AATACGACAT CTAATGTGCA ATGAAAGCTA ACCTCCCATT TTATAAAGAA ATAGACAGTG CACCCAATCA
AATAGACAGT GCCTATTGAA ATGCTTCATC CCAGTAAAGC TTTAAAAATA AGTCCAGCCC AGTTAAAACA CATTACACAG
ATCAAATACA TCTATATGGC CGATTTCAAC CCAGGTTTAT TCACCATTCT GAGGCGTAGC TAGCTCTATC ACCATAATTA
GTTTAGTTTA TCATTCAAAA TATATACGAG GCAAAATTCA TGTTTTTTTT GTGGCCCATT TCAATCCAGG TTTATTCACC
ATTCTGAGGG GCCCTGTAAA ATTCCTTCTA TAAATATAGA AGAGGCAAAG GTTTTGCCCT TCATTCAAAA AAATAATTAG
TTTATCATGT TTTTTTTATC TGTTTTGAGT GTTGACTGTA GTGTTTCACC TTTTCCATCT TACTCTCTGC TTTCAGAAAA
GGGACCAAAT CTGAGGCTCC AGCAACATGC TATGGTTGTC ATGGTGTAGG AATGAGGAAT ATAATGCGAC AGATAGGACT
AGGCATGATT CAACATATGC AGACTGTCTG TCCTGAATGC AGAGGATCAG GTATGCAACA GTTGCTCCAA TTTTTATGCT
ATATCTTGCT GCAAAATTGT GATTTCTTAG GAGCCTGCTT TATGTTTGTA ATGTTCTATA CTTGATCAGG TGAGATCATA
AGTGACAGGG ATAAATGCAC AAACTGCAGA GCTAGCAAAG TTATTCAGGA GAAAAAGGTG CTTGAGGTTC ATATTGAGAA
GGGAATGCAA CATGGCCAAA AAATTGTATT CCAAGGTGAA GCTGATGAAG CTGTAAGTTT ATTTTGTCCA TTTATACTAG
TATACATACT TGCAGCCACA TATTCATCCA TCCTTGTGCT AATGAATATC TGTGCATGCA CTACTTTCTT TATCTAATAT
TTTGCACTGT GTGTTTCATG CTGTTGCAGC CTGATACAGT GACAGGAGAT ATAGTATTTA TCTTGCAAGT TAAGGTACAT
CCAAGATTTA AGAGGAAATA TGATGACCTG TTCATTGAGC GCACAATCTC TTTAACTGAG GCATTGTGTG GGTTCCAATT
CATCCTCACT CATCTGGACA GTAGGCAGCT CCTAATCAAG GCAAATCCTG GCGAAATTAT TAAACCTGGT ATCTCATCCC
CTTAAAATGC TAGCCTTTTT GTTTGCCACT TCGTAATTCT GTTTTTTCTA TTCAGATTCT AATCAGTTGC AGACTTTTTT
AAAGAATTAA CTCAAATATT TTCCAAACAG GTCAACACAA GGCCATAAAT GATGAGGGAA TGCCACACCA TGGCCGGCCT
TTCATGAAGG GCCGTCTCTT TGTGGAATTC AATGTTGAGT TCCCTGAATC TGGTGTACTC TCCCGTGACC AATGCCGGGC
ACTTGAGATG ATCCTACCAC CTAAACCTGG GCACCAATTA TCAGATATGG ACCTGGATCA ATGTGAGGAA ACTACCATGC
ATGATGTGAA CATAGAAGAG GAGATGAGGC GCAAGCAGTA TCAAAGGAAG CAGGAAGCGT ACGACGAAGA TGAGGAGGAG
GATGCTCCAA GAGTACAGTG TGCTCAACAG TAAGAAGTGT CACTTTCTGG CGCAAGTGAT GATACTCCAT GTAAACTAAG
TAGTTTTTGG TGAGACTGTT CATTTTAGTG TATTTTGTAC TAGTTAAATT AAATAGTGAA TGTCTAAGTT GTGTCGTTTG
ATATATAAGC TTGTGCTAAC AACATAAGGC TTTCTTGGCC TTCATAAGAT ATACTCCTAC CTAGGAGAAA GTGGTGGATG
AGC

Locus: Os04g0549600

Loading...

Locus: Os04g0549600

Loading...