Os04t0551500-01

Locus

Os04g0551500

Description

SBP domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SPL7

CGSNL Gene Name

RICE SQUAMOSA PROMOTER-BINDING-LIKE 7

Oryzabase Gene Symbol Synonym(s)

OsSPL7

Oryzabase Gene Name Synonym(s)

Squamosa promoter-binding-like protein 7

Transcript Evidence

AK068749 (DDBJ, Best hit)

Protein Evidence

Q7XT42 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

Transcription factor, SBP-box (IPR004333)

Full-length cDNA

J013158C23 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0551500-01)

RiceXPro (AK068749)

Others

Oryzabase (6890)

KEGG (Os04t0551500-01)

Transcript

1517 bp

>Os04t0551500-01 SBP domain containing protein.
TTACAACCGCCGCCGCAGCCTTTTTCCCAATCGGCGCTAGTTTTCGATCCGCCGCCGTCG
GCCGGAGCGAAGCCAAGCCCGCGCGACCAGGTGGCTGCTGCTGTGTAACGACGCTAGCTA
GCTTAGCTGCGGTACGTTTACACATAGGTCCGTCCGTGTGCGGCTGCCACCATGGAAGGA
AACGGCTGCGGCGGAAGCGGGGCGACACCACGTGGTGTCGTTGGGATGCACTGGGCTCCC
GTCGTCACCTCGCCGCCTAGCCCGCAGCCGCCGTTCCTCCCGCCGGCGCCATGCAGGCCC
GACGTCCAGATGCAACAGCAAGGCGGGCTGACCTGCCTCAAGCTCGGGAAGCGGCCGTGC
TTCTGGGGTGGCGACGGCGCCGGCCAGGTGGCGCAGGGGAGCGGCGGCGGCGGAGGCGGA
GGCGGTGGTGGTTCCGCGGATCAGGGGAAGAGGAAGGAGAAGGCGGCGACGGCGGTGCCG
GTGGTGCCCCGTTGCCAGGTGGAGGGGTGCGACATTACGCTCCAGGGAGTCAAGGAGTAC
CACCGGCGGCACAAGGTGTGCGAGGTGCACGCCAAGGCCCCGAGGGTCGTCGTGCACGGC
ACCGAGCAGCGCTTCTGCCAGCAATGCAGCCGGTTCCACGTGCTCGCGGAGTTTGACGAC
GCCAAGAAGAGCTGCCGGCGGCGGCTGGCCGGGCACAACGAGAGGCGGCGGAGGAGCAAC
GCCAGCGAGGCCATGGCCAGGGGCTCTGCGCACCCACACGGTATGCCGGTGCTGGGACAC
GGTTTCCCGCCGTACGGCCTGCCGACGTCGTCGGCTGGTGCTCTCTCTCTTCTGTCATCG
GCTAGAGCCACCGGCCCATGGCTGATGCCGACGCCCGACATCTCCGCCCGCTCAAGCGCG
GCGCTCGACGAGCTCATCGCCGAGAACCGCGCGGCCCTCCTCTCGTGGCAATTCTTCTCC
GACCGACAGCCGCCACCAGCTGGCCGTCCAACGGGCCGCAGCCCGGGCTCCGAAACGGCC
GGTGGCTGGCACGCGCACCTGCAGGCGCGGCCGCCACCGCCCGGCGCCGGAGGGCAGCAC
GAGAATCAGTCGGGGCACGTGACGCTCGACCTCATGCAGGCCACCACCGCGGCAGGAGGC
AGCGGCGCGCCGTTCCGGCCCGTGCCAGCGAGGCCCCCCAAGGAGGGCGGCGACGCCGGC
TGCACCTCCGACGCGTGGACGCCGTCGCCCATGGAGGGCGCCCGCGTGGTCTGAGTGTCC
GACCTGCCAGCCGCGACGTCGCCGCGCGTGCACCACGGTCCCTAGCTCCCGTGTCAGCTG
GGCGTGGGAAGCGATCGATCAGTGGTGGGCGCGCGCGCACGGCTGGAGCTCTGTCCCGAC
GCCGCGCGCAGCCGTGCAATCAACTTGAGTTCGTTGGACAATAGTGTCTCGTCTCGTAGC
AATCTATCCCGATGTAGCAGTACTGGTGCAGTGGTGGTGGTGGTGCCACTAGCTAGCAAT
GTTCTATTTTTTCGCTC

CDS

1083 bp

>Os04t0551500-01 SBP domain containing protein.
ATGGAAGGAAACGGCTGCGGCGGAAGCGGGGCGACACCACGTGGTGTCGTTGGGATGCAC
TGGGCTCCCGTCGTCACCTCGCCGCCTAGCCCGCAGCCGCCGTTCCTCCCGCCGGCGCCA
TGCAGGCCCGACGTCCAGATGCAACAGCAAGGCGGGCTGACCTGCCTCAAGCTCGGGAAG
CGGCCGTGCTTCTGGGGTGGCGACGGCGCCGGCCAGGTGGCGCAGGGGAGCGGCGGCGGC
GGAGGCGGAGGCGGTGGTGGTTCCGCGGATCAGGGGAAGAGGAAGGAGAAGGCGGCGACG
GCGGTGCCGGTGGTGCCCCGTTGCCAGGTGGAGGGGTGCGACATTACGCTCCAGGGAGTC
AAGGAGTACCACCGGCGGCACAAGGTGTGCGAGGTGCACGCCAAGGCCCCGAGGGTCGTC
GTGCACGGCACCGAGCAGCGCTTCTGCCAGCAATGCAGCCGGTTCCACGTGCTCGCGGAG
TTTGACGACGCCAAGAAGAGCTGCCGGCGGCGGCTGGCCGGGCACAACGAGAGGCGGCGG
AGGAGCAACGCCAGCGAGGCCATGGCCAGGGGCTCTGCGCACCCACACGGTATGCCGGTG
CTGGGACACGGTTTCCCGCCGTACGGCCTGCCGACGTCGTCGGCTGGTGCTCTCTCTCTT
CTGTCATCGGCTAGAGCCACCGGCCCATGGCTGATGCCGACGCCCGACATCTCCGCCCGC
TCAAGCGCGGCGCTCGACGAGCTCATCGCCGAGAACCGCGCGGCCCTCCTCTCGTGGCAA
TTCTTCTCCGACCGACAGCCGCCACCAGCTGGCCGTCCAACGGGCCGCAGCCCGGGCTCC
GAAACGGCCGGTGGCTGGCACGCGCACCTGCAGGCGCGGCCGCCACCGCCCGGCGCCGGA
GGGCAGCACGAGAATCAGTCGGGGCACGTGACGCTCGACCTCATGCAGGCCACCACCGCG
GCAGGAGGCAGCGGCGCGCCGTTCCGGCCCGTGCCAGCGAGGCCCCCCAAGGAGGGCGGC
GACGCCGGCTGCACCTCCGACGCGTGGACGCCGTCGCCCATGGAGGGCGCCCGCGTGGTC
TGA

Protein

361 aa

>Os04t0551500-01 SBP domain containing protein.
MEGNGCGGSGATPRGVVGMHWAPVVTSPPSPQPPFLPPAPCRPDVQMQQQGGLTCLKLGK
RPCFWGGDGAGQVAQGSGGGGGGGGGGSADQGKRKEKAATAVPVVPRCQVEGCDITLQGV
KEYHRRHKVCEVHAKAPRVVVHGTEQRFCQQCSRFHVLAEFDDAKKSCRRRLAGHNERRR
RSNASEAMARGSAHPHGMPVLGHGFPPYGLPTSSAGALSLLSSARATGPWLMPTPDISAR
SSAALDELIAENRAALLSWQFFSDRQPPPAGRPTGRSPGSETAGGWHAHLQARPPPPGAG
GQHENQSGHVTLDLMQATTAAGGSGAPFRPVPARPPKEGGDAGCTSDAWTPSPMEGARVV
*

5'UTR

chr04:27614776..27614946 (+ strand) : 171 bp

CDS

chr04:27614947..27615407 (+ strand) : 461 bp

chr04:27615490..27615617 (+ strand) : 128 bp

chr04:27617245..27617738 (+ strand) : 494 bp

3'UTR

chr04:27617739..27618001 (+ strand) : 263 bp

FASTA

>Os04t0551500-01 class=Sequence position=chr04:27614776..27618001 (+ strand)
TTACAACCGC CGCCGCAGCC TTTTTCCCAA TCGGCGCTAG TTTTCGATCC GCCGCCGTCG GCCGGAGCGA AGCCAAGCCC
GCGCGACCAG GTGGCTGCTG CTGTGTAACG ACGCTAGCTA GCTTAGCTGC GGTACGTTTA CACATAGGTC CGTCCGTGTG
CGGCTGCCAC CATGGAAGGA AACGGCTGCG GCGGAAGCGG GGCGACACCA CGTGGTGTCG TTGGGATGCA CTGGGCTCCC
GTCGTCACCT CGCCGCCTAG CCCGCAGCCG CCGTTCCTCC CGCCGGCGCC ATGCAGGCCC GACGTCCAGA TGCAACAGCA
AGGCGGGCTG ACCTGCCTCA AGCTCGGGAA GCGGCCGTGC TTCTGGGGTG GCGACGGCGC CGGCCAGGTG GCGCAGGGGA
GCGGCGGCGG CGGAGGCGGA GGCGGTGGTG GTTCCGCGGA TCAGGGGAAG AGGAAGGAGA AGGCGGCGAC GGCGGTGCCG
GTGGTGCCCC GTTGCCAGGT GGAGGGGTGC GACATTACGC TCCAGGGAGT CAAGGAGTAC CACCGGCGGC ACAAGGTGTG
CGAGGTGCAC GCCAAGGCCC CGAGGGTCGT CGTGCACGGC ACCGAGCAGC GCTTCTGCCA GCAATGCAGC CGGTGCGTCA
ATCACCACGA TCTACGTCAC ATGTCTAGCT CTGCTACACG CGTGCTCATA GCGGTCTTTC ACTTGTACGC GCAGGTTCCA
CGTGCTCGCG GAGTTTGACG ACGCCAAGAA GAGCTGCCGG CGGCGGCTGG CCGGGCACAA CGAGAGGCGG CGGAGGAGCA
ACGCCAGCGA GGCCATGGCC AGGGGCTCTG CGCACCCACA CGGTATACAC AAAACAAACT CCTCCCGTCC CGGCCGTAAC
AGTTCCATTA ATCATCATAC TACTAGTACG TGTAGTACGT ACGTACTACT CCCAGTAATA GTTAGGGAGA CCAATGGAGA
GGCAGGTTAG CTGCACAAAC AGGAGCGTAC CACTCCCAGT AGTAGGAGTA CTGGTTGGTT TGATGCCGGG AAACAAGGGG
AGAGCTGCAG GTGCGCACCA AAAAGCTCAT CGGGATGTGT GAGACGCTGA GAGCACAGAT TTTAATGCAC GACTTTATGT
GCACTGCGCT GCCTGCCTGG CCGGCCCAGC CAGCCTGCTT GCTTGGAGTG GCAGTGGCTG CGTGGCCACT GGCCAGGCCG
ACCGTGCATA TGATCACCAT GGCATCAACA GGAACCCGCG CGCCGGGTGG TCGCTGCGCA CGCAACACGG CAAACAGTGG
TTTCATCCAT CCATCTTCCA CTCCTTATCA AGAGCCTGTA TGCTTACGGA AATCTATACT ACTACGTACT AGTACTACTA
CTCCAGTACG CATGTACATA CATACGCGTA CAACTGTACA GTTAATTACG AATAGTTACT GTACGAAGGT ATAGTGCTAT
AGCGGGACTG GCCGAAAGAC TTGGACATAC GGCGGTCGAA TTTCATAGCG GCATTCTAGG ATATTCAAGC GTGTATTGAT
TGATATTGAT ATGCTTTCAT GAGTATAGTT GTACTACTGA CCTTCAAAGG TAAGCACGGC TCTGCAGTTC AGAAACCTTG
TATATATGTA TACTCCTttt gtcccataaa aaaacaatat agtgtcagat atgacttatt ctaatactac gaattttgat
atacatctgt ccagattcat agattTATTT TTATAGGAAG GAGGGAGTAC TCCTTTTAGT CTACCACTAC CTTTCTCTTG
TTCTGAGAAA CTATTACTCC TGCAGTAGAA AATACAGTAC ATGGTACTCC TGCTGCACTG ACATAGATCC TGTAGATGAA
CATGCCTTAT ATTCTGTGAT AACTTATGTA CTCCAGTATT TATGTGGACT TTGATTTGGA GTAGGTCCTT CTGGCTGTCT
TACAGAGAAA TATTATGGAA TGCAAGATTT AAGTTAGTTG CCTCAAACAA TAAAGACATT AACAATCGTA ACCACCACAA
ACTTTCGTGT CAACATAATC AACAACAGCA TAATGGGCCT ATCTTGGTTA ACAATAACAT TAGTACGTAT TACCATGGAC
CTAAACTTGA CATCAAGGTC GAGTGCACGT TTTTACTATG CTAGTGACCC AAAGCCCATC AGCATTATTG ACCACTTGAA
ACCTGTTATT TGATCAACAC ATAGACATGA TGTTGTGGAA GATCAGGTAG CGATCAGTTT GTGTAAAGAT ATATAGTATA
GTATCAATTA GTTGTACCCG GTGAACATGC ATGGTTGGTT GGTTTTAAAC TTTGTAAATT TGGTTGCAAA TGATCAGGGC
AAGCATGCAA AAATGATTGC GGTTGAGTAA CCACTTCGTT ATTAGGACTG ATGGTGTGCA TTATGCTTTC TTGATATGAC
TATAACAGAT GGCCACATTT CTGTAGGCAC AATGATATGC ATAATAACGT GTCGACGTTG TTGTTGCAGG TATGCCGGTG
CTGGGACACG GTTTCCCGCC GTACGGCCTG CCGACGTCGT CGGCTGGTGC TCTCTCTCTT CTGTCATCGG CTAGAGCCAC
CGGCCCATGG CTGATGCCGA CGCCCGACAT CTCCGCCCGC TCAAGCGCGG CGCTCGACGA GCTCATCGCC GAGAACCGCG
CGGCCCTCCT CTCGTGGCAA TTCTTCTCCG ACCGACAGCC GCCACCAGCT GGCCGTCCAA CGGGCCGCAG CCCGGGCTCC
GAAACGGCCG GTGGCTGGCA CGCGCACCTG CAGGCGCGGC CGCCACCGCC CGGCGCCGGA GGGCAGCACG AGAATCAGTC
GGGGCACGTG ACGCTCGACC TCATGCAGGC CACCACCGCG GCAGGAGGCA GCGGCGCGCC GTTCCGGCCC GTGCCAGCGA
GGCCCCCCAA GGAGGGCGGC GACGCCGGCT GCACCTCCGA CGCGTGGACG CCGTCGCCCA TGGAGGGCGC CCGCGTGGTC
TGAGTGTCCG ACCTGCCAGC CGCGACGTCG CCGCGCGTGC ACCACGGTCC CTAGCTCCCG TGTCAGCTGG GCGTGGGAAG
CGATCGATCA GTGGTGGGCG CGCGCGCACG GCTGGAGCTC TGTCCCGACG CCGCGCGCAG CCGTGCAATC AACTTGAGTT
CGTTGGACAA TAGTGTCTCG TCTCGTAGCA ATCTATCCCG ATGTAGCAGT ACTGGTGCAG TGGTGGTGGT GGTGCCACTA
GCTAGCAATG TTCTATTTTT TCGCTC

Locus: Os04g0551500

Loading...

Locus: Os04g0551500

Loading...