Os04t0556000-01

Locus

Os04g0556000

Description

Heavy metal P-type ATPase, Xylem loading of copper

RAP-DB Gene Symbol Synonym(s)

HMA5, OsHMA8, OsHMA5, HMA8

RAP-DB Gene Name Synonym(s)

HEAVY METAL ATPASE 5, heavy metal ATPase 8, heavy metal ATPase 5, heavy metal P-type ATPase 5

CGSNL Gene Symbol

HMA5

CGSNL Gene Name

HEAVY METAL ATPASE 5

Oryzabase Gene Symbol Synonym(s)

OsHMA8, osHMA5, HMA8, OsHMP27, HMP27

Oryzabase Gene Name Synonym(s)

heavy metal ATPase 8, heavy metal ATPase 5, heavy metal P-Type ATPase 5, Heavy metal-associated protein 27

Transcript Evidence

AK072990

Protein Evidence

A3AWA4

Literature

PMID: 24064929

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

November 18, 2013

Gene Ontology (GO)

Biological Process: cation transport (GO:0006812)

Biological Process: metal ion transport (GO:0030001)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: copper ion binding (GO:0005507)

Molecular Function: cation-transporting ATPase activity (GO:0019829)

Molecular Function: metal ion binding (GO:0046872)

Cellular Component: integral component of membrane (GO:0016021)

Functional domain (InterPro)

P-type ATPase (IPR001757)

P-type ATPase, subfamily IB (IPR027256)

Heavy metal-associated domain, HMA (IPR006121)

Heavy metal-associated domain, copper ion-binding (IPR006122)

P-type ATPase, A domain (IPR008250)

HAD-like domain (IPR023214)

P-type ATPase, cytoplasmic domain N (IPR023299)

Heavy-metal-associated, conserved site (IPR017969)

P-type ATPase, phosphorylation site (IPR018303)

Full-length cDNA

J023144D18 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0556000-01)

Others

Oryzabase (13011)

Transcript

3195 bp

>Os04t0556000-01 Heavy metal P-type ATPase, Xylem loading of copper
GGGGGTCACGCGAACACGCTGCCAATGGCGGCGAGCACTCGAGCCCTCTTCCTCTCCTGC
TTCCACGGAAGCGGCGGCGGCGGCGGCACTTCCGAGGTGAGCCGCCGCCTCGTGCTGCGG
CCGCGGTACCCGTCCATGCCGCGGCGACCGAGGTCGGCCGCGGTCGCCGGAGAGGGAGGG
GAAGGAGGAGGAGGAGGAGGCGACGGCGATCTGGAGGCGGCGGCCGTGGGGGCGGAGGAG
GAGGAGAAGGTGGCGGTGTTCGAGGTGTCCGGGATGACGTGCGCCGCGTGCGCGGGCTCG
GTGGAGAAGGCCGTCAAGCGGCTCCAGGGCATCCACGACGCCGCCGTCGACGTCCTCGGG
GGCCGCGCGCAGGTCGTCTTCTACCCGGCGTTCGTCTCGGAGGAAAAAATTAGGGAAACC
ATCCAGGATGTGGGCTTTGAAGCTAAGCTGATTGATGAGGAAGTCAAGGAAAAAAACATT
CTAGTATGCAGGCTGCACATAAAAGGAATGACCTGCACATCTTGTGCGAGCACAGTGGAA
TCCATCTTGCAAGTTGTTCCTGGTGTTCAGAGAGCTTCTGTCGCATTGGCTACTGAAGAG
GCAGAAATCCGTTATGACCGTAGAATCGTTACTGCCAGTCAACTAACCCATGCAGTTGAA
GAGACGGGTTTTGAAGCAATACTGATCACCACTGGAGATGATCAGAGCAGGATAGACCTC
AAAGTGGATGGCACACTCAACGAGAGATCAATCATGATAGTGAAAAGCTCTGTCCAAGCT
CTTCCTGGTGTGGAAGACATAAAAGTTGATCCTGAGCTCCACAAGATCACCATCTCATAC
AAACCTGACCAGACAGGTCCTCGAGACCTCATTGAAGTCATTGAGTCAGCTGCCTCTGGT
GATCTTACTGTATCGATATACCCAGAAGCAGATGGAAGGCAGCAGCATAGACATGGGGAG
ATCAAGCGATACAGGCAGTCTTTCTTGTGGAGTTTAGTATTCACCATCCCGGTATTCCTC
ACCTCCATGGTGTTCATGTACATCCCAGGGCTGAAGGATGGGCTCGAAAAGAAGGTTATT
AACATGATGAGCATTGGTGAGCTCTTGCGGTGGATTTTGTCAACGCCAGTTCAATTTGTA
ATTGGCCGCAGATTTTATACTGGTGCTTATAAAGCGTTATCCCACGGCTCATCAAACATG
GATGTACTCATTGCTCTTGGGACCAACACAGCTTACTTCTACTCAGTTTACTCCATCCTC
CGAGCTGCCTCCTCACATAATTACATGGCAACTGATTTTTTTGAAACTAGTTCAATGCTC
ATATCGTTTATCCTTCTTGGAAAGTACCTTGAGATCTTGGCAAAAGGGAAGACCTCTGAG
GCTATTGCCAAGCTTATGGATCTTGCACCAGAAACTGCAACTATGTTGATATATGATCAT
GAAGGGAATGTTGTGGGCGAGAAGGAAATTGACAGTAGGTTGATTCAGAAAAATGATGTG
ATCAAAGTAGTCCCAGGTGGGAAAGTTGCTTCTGATGGCTTTGTTATATGGGGACAGAGC
CATGTGAATGAAAGCATGATCACCGGAGAATCACGACCTGTGGCAAAGAGGAAGGGTGAC
ACTGTCATAGGAGGGACGGTGAATGAGAATGGTGTGCTTCATGTCCGTGCAACATTTGTT
GGATCAGAGAGTGCCCTTGCACAGATTGTACGGCTAGTAGAGTCAGCGCAAATGGCAAAA
GCTCCTGTACAAAAGTTTGCTGATCAGATATCTAGAGTCTTTGTTCCCCTGGTCATCATT
CTTTCTTTGCTTACTTGGCTTGCTTGGTTCTTAGCTGGGAGGCTTCATGGTTACCCTAAC
TCATGGATACCATCTTCCATGGATAGCTTTCAACTAGCTCTCCAATTCGGGATATCAGTT
ATGGTTATTGCATGCCCTTGCGCCTTAGGGCTTGCAACTCCAACAGCTGTGATGGTTGCT
ACTGGAGTTGGTGCCTCACAAGGAGTTCTTATCAAGGGTGGGCAAGCTCTGGAGAGTGCA
CAGAAGGTCGACTGCATCGTTTTCGACAAGACAGGGACACTAACCATTGGGAAGCCTGTT
GTGGTCAACACAAGACTGTTAAAAAACATGGTCTTGCGTGAATTCTATGCTTACGTTGCA
GCAGCAGAGGTCAACAGTGAGCACCCACTGGGTAAGGCAGTCGTGGAGCATGCCAAGAAG
TTCCATTCGGAAGAGAGCCATGTCTGGACTGAAGCAAGGGATTTCATTTCAGTGACAGGG
CACGGTGTCAAGGCAAAAATAAGTGGCAGGGCTGTTATGGTGGGAAACAAGAGCTTTATG
TTGACTTCAGGCATTGATATCCCGGTGGAAGCTTTGGAAATCCTAACGGAAGAAGAGGAG
AAGGCCCAAACAGCGATCATTGTGGCTATGGATCAAGAAGTCGTGGGCATTATCTCTGTA
TCTGATCCAATAAAACCAAATGCCCGCGAAGTGATTTCGTATCTCAAATCTATGAAGGTG
GAGAGTATAATGGTGACTGGGGACAACTGGGGGACTGCCAATGCCATTAGCAAAGAGGTT
GGCATTGAGAACACAGTTGCAGAAGCGAAACCAGAGCAGAAAGCTGAGAAGGTGAAAGAA
CTTCAGTCGGCCGGAAGGACCGTGGCAATGGTTGGTGATGGAATCAACGATTCTCCAGCG
CTTGTATCAGCCGACGTTGGCCTGGCGATTGGCGCAGGCACTGACGTCGCCATTGAAGCG
GCCGACATCGTCCTCATGAAGAGCAACCTGGAAGACGTGATCACCGCCATCGATCTGTCC
AGAAAAACCTTCTTCCGCATACGGATGAACTACGTCTGGGCGCTCGGCTACAACATCATC
GGCATACCGATCGCTGCCGGGGTGCTCTTCCCGTCGACCCGGTTCCGCTTGCCGCCATGG
GTCGCCGGCGCTGCGATGGCTGCTTCCTCCGTTAGCGTCGTCTGCTGGTCCCTGCTGTTG
AGGTACTACAAGAGCCCAAAACTGGGCCGTTGATCATGCAGTACACACGCATAGCATTTG
CTTAGAATAAGAGGTGTAGATATCTGTTGACAATGTGCTAATGTGGTTCTAAAAGAAATG
TGCTAGTGTGTGTTGTGTGGCACCTGAAATGTGTACATTACCTACGTATATATGCACCGT
GTGTTTACAAGTGTT

CDS

3009 bp

>Os04t0556000-01 Heavy metal P-type ATPase, Xylem loading of copper
ATGGCGGCGAGCACTCGAGCCCTCTTCCTCTCCTGCTTCCACGGAAGCGGCGGCGGCGGC
GGCACTTCCGAGGTGAGCCGCCGCCTCGTGCTGCGGCCGCGGTACCCGTCCATGCCGCGG
CGACCGAGGTCGGCCGCGGTCGCCGGAGAGGGAGGGGAAGGAGGAGGAGGAGGAGGCGAC
GGCGATCTGGAGGCGGCGGCCGTGGGGGCGGAGGAGGAGGAGAAGGTGGCGGTGTTCGAG
GTGTCCGGGATGACGTGCGCCGCGTGCGCGGGCTCGGTGGAGAAGGCCGTCAAGCGGCTC
CAGGGCATCCACGACGCCGCCGTCGACGTCCTCGGGGGCCGCGCGCAGGTCGTCTTCTAC
CCGGCGTTCGTCTCGGAGGAAAAAATTAGGGAAACCATCCAGGATGTGGGCTTTGAAGCT
AAGCTGATTGATGAGGAAGTCAAGGAAAAAAACATTCTAGTATGCAGGCTGCACATAAAA
GGAATGACCTGCACATCTTGTGCGAGCACAGTGGAATCCATCTTGCAAGTTGTTCCTGGT
GTTCAGAGAGCTTCTGTCGCATTGGCTACTGAAGAGGCAGAAATCCGTTATGACCGTAGA
ATCGTTACTGCCAGTCAACTAACCCATGCAGTTGAAGAGACGGGTTTTGAAGCAATACTG
ATCACCACTGGAGATGATCAGAGCAGGATAGACCTCAAAGTGGATGGCACACTCAACGAG
AGATCAATCATGATAGTGAAAAGCTCTGTCCAAGCTCTTCCTGGTGTGGAAGACATAAAA
GTTGATCCTGAGCTCCACAAGATCACCATCTCATACAAACCTGACCAGACAGGTCCTCGA
GACCTCATTGAAGTCATTGAGTCAGCTGCCTCTGGTGATCTTACTGTATCGATATACCCA
GAAGCAGATGGAAGGCAGCAGCATAGACATGGGGAGATCAAGCGATACAGGCAGTCTTTC
TTGTGGAGTTTAGTATTCACCATCCCGGTATTCCTCACCTCCATGGTGTTCATGTACATC
CCAGGGCTGAAGGATGGGCTCGAAAAGAAGGTTATTAACATGATGAGCATTGGTGAGCTC
TTGCGGTGGATTTTGTCAACGCCAGTTCAATTTGTAATTGGCCGCAGATTTTATACTGGT
GCTTATAAAGCGTTATCCCACGGCTCATCAAACATGGATGTACTCATTGCTCTTGGGACC
AACACAGCTTACTTCTACTCAGTTTACTCCATCCTCCGAGCTGCCTCCTCACATAATTAC
ATGGCAACTGATTTTTTTGAAACTAGTTCAATGCTCATATCGTTTATCCTTCTTGGAAAG
TACCTTGAGATCTTGGCAAAAGGGAAGACCTCTGAGGCTATTGCCAAGCTTATGGATCTT
GCACCAGAAACTGCAACTATGTTGATATATGATCATGAAGGGAATGTTGTGGGCGAGAAG
GAAATTGACAGTAGGTTGATTCAGAAAAATGATGTGATCAAAGTAGTCCCAGGTGGGAAA
GTTGCTTCTGATGGCTTTGTTATATGGGGACAGAGCCATGTGAATGAAAGCATGATCACC
GGAGAATCACGACCTGTGGCAAAGAGGAAGGGTGACACTGTCATAGGAGGGACGGTGAAT
GAGAATGGTGTGCTTCATGTCCGTGCAACATTTGTTGGATCAGAGAGTGCCCTTGCACAG
ATTGTACGGCTAGTAGAGTCAGCGCAAATGGCAAAAGCTCCTGTACAAAAGTTTGCTGAT
CAGATATCTAGAGTCTTTGTTCCCCTGGTCATCATTCTTTCTTTGCTTACTTGGCTTGCT
TGGTTCTTAGCTGGGAGGCTTCATGGTTACCCTAACTCATGGATACCATCTTCCATGGAT
AGCTTTCAACTAGCTCTCCAATTCGGGATATCAGTTATGGTTATTGCATGCCCTTGCGCC
TTAGGGCTTGCAACTCCAACAGCTGTGATGGTTGCTACTGGAGTTGGTGCCTCACAAGGA
GTTCTTATCAAGGGTGGGCAAGCTCTGGAGAGTGCACAGAAGGTCGACTGCATCGTTTTC
GACAAGACAGGGACACTAACCATTGGGAAGCCTGTTGTGGTCAACACAAGACTGTTAAAA
AACATGGTCTTGCGTGAATTCTATGCTTACGTTGCAGCAGCAGAGGTCAACAGTGAGCAC
CCACTGGGTAAGGCAGTCGTGGAGCATGCCAAGAAGTTCCATTCGGAAGAGAGCCATGTC
TGGACTGAAGCAAGGGATTTCATTTCAGTGACAGGGCACGGTGTCAAGGCAAAAATAAGT
GGCAGGGCTGTTATGGTGGGAAACAAGAGCTTTATGTTGACTTCAGGCATTGATATCCCG
GTGGAAGCTTTGGAAATCCTAACGGAAGAAGAGGAGAAGGCCCAAACAGCGATCATTGTG
GCTATGGATCAAGAAGTCGTGGGCATTATCTCTGTATCTGATCCAATAAAACCAAATGCC
CGCGAAGTGATTTCGTATCTCAAATCTATGAAGGTGGAGAGTATAATGGTGACTGGGGAC
AACTGGGGGACTGCCAATGCCATTAGCAAAGAGGTTGGCATTGAGAACACAGTTGCAGAA
GCGAAACCAGAGCAGAAAGCTGAGAAGGTGAAAGAACTTCAGTCGGCCGGAAGGACCGTG
GCAATGGTTGGTGATGGAATCAACGATTCTCCAGCGCTTGTATCAGCCGACGTTGGCCTG
GCGATTGGCGCAGGCACTGACGTCGCCATTGAAGCGGCCGACATCGTCCTCATGAAGAGC
AACCTGGAAGACGTGATCACCGCCATCGATCTGTCCAGAAAAACCTTCTTCCGCATACGG
ATGAACTACGTCTGGGCGCTCGGCTACAACATCATCGGCATACCGATCGCTGCCGGGGTG
CTCTTCCCGTCGACCCGGTTCCGCTTGCCGCCATGGGTCGCCGGCGCTGCGATGGCTGCT
TCCTCCGTTAGCGTCGTCTGCTGGTCCCTGCTGTTGAGGTACTACAAGAGCCCAAAACTG
GGCCGTTGA

Protein

1003 aa

>Os04t0556000-01 Heavy metal P-type ATPase, Xylem loading of copper
MAASTRALFLSCFHGSGGGGGTSEVSRRLVLRPRYPSMPRRPRSAAVAGEGGEGGGGGGD
GDLEAAAVGAEEEEKVAVFEVSGMTCAACAGSVEKAVKRLQGIHDAAVDVLGGRAQVVFY
PAFVSEEKIRETIQDVGFEAKLIDEEVKEKNILVCRLHIKGMTCTSCASTVESILQVVPG
VQRASVALATEEAEIRYDRRIVTASQLTHAVEETGFEAILITTGDDQSRIDLKVDGTLNE
RSIMIVKSSVQALPGVEDIKVDPELHKITISYKPDQTGPRDLIEVIESAASGDLTVSIYP
EADGRQQHRHGEIKRYRQSFLWSLVFTIPVFLTSMVFMYIPGLKDGLEKKVINMMSIGEL
LRWILSTPVQFVIGRRFYTGAYKALSHGSSNMDVLIALGTNTAYFYSVYSILRAASSHNY
MATDFFETSSMLISFILLGKYLEILAKGKTSEAIAKLMDLAPETATMLIYDHEGNVVGEK
EIDSRLIQKNDVIKVVPGGKVASDGFVIWGQSHVNESMITGESRPVAKRKGDTVIGGTVN
ENGVLHVRATFVGSESALAQIVRLVESAQMAKAPVQKFADQISRVFVPLVIILSLLTWLA
WFLAGRLHGYPNSWIPSSMDSFQLALQFGISVMVIACPCALGLATPTAVMVATGVGASQG
VLIKGGQALESAQKVDCIVFDKTGTLTIGKPVVVNTRLLKNMVLREFYAYVAAAEVNSEH
PLGKAVVEHAKKFHSEESHVWTEARDFISVTGHGVKAKISGRAVMVGNKSFMLTSGIDIP
VEALEILTEEEEKAQTAIIVAMDQEVVGIISVSDPIKPNAREVISYLKSMKVESIMVTGD
NWGTANAISKEVGIENTVAEAKPEQKAEKVKELQSAGRTVAMVGDGINDSPALVSADVGL
AIGAGTDVAIEAADIVLMKSNLEDVITAIDLSRKTFFRIRMNYVWALGYNIIGIPIAAGV
LFPSTRFRLPPWVAGAAMAASSVSVVCWSLLLRYYKSPKLGR*

5'UTR

chr04:27829841..27829864 (+ strand) : 24 bp

CDS

chr04:27829865..27830239 (+ strand) : 375 bp

chr04:27832163..27833554 (+ strand) : 1392 bp

chr04:27833632..27833886 (+ strand) : 255 bp

chr04:27833968..27834090 (+ strand) : 123 bp

chr04:27834365..27834841 (+ strand) : 477 bp

chr04:27834938..27835324 (+ strand) : 387 bp

3'UTR

chr04:27835325..27835486 (+ strand) : 162 bp

FASTA

>Os04t0556000-01 class=Sequence position=chr04:27829841..27835486 (+ strand)
GGGGGTCACG CGAACACGCT GCCAATGGCG GCGAGCACTC GAGCCCTCTT CCTCTCCTGC TTCCACGGAA GCGGCGGCGG
CGGCGGCACT TCCGAGGTGA GCCGCCGCCT CGTGCTGCGG CCGCGGTACC CGTCCATGCC GCGGCGACCG AGGTCGGCCG
CGGTCGCCGG AGAGGGAGGG GAAGGAGGAG GAGGAGGAGG CGACGGCGAT CTGGAGGCGG CGGCCGTGGG GGCGGAGGAG
GAGGAGAAGG TGGCGGTGTT CGAGGTGTCC GGGATGACGT GCGCCGCGTG CGCGGGCTCG GTGGAGAAGG CCGTCAAGCG
GCTCCAGGGC ATCCACGACG CCGCCGTCGA CGTCCTCGGG GGCCGCGCGC AGGTCGTCTT CTACCCGGCG TTCGTCTCGG
TGAGTATCGA AGGCTCCGTC GCTCCGATTT TTCCATATAT TTTTTTTAAA GCATGCCGCG TTTCTTACGG GCTGCTTGCT
TCCCGCACGA CCAGATTGAT CAGCCTGTGG ATAGCTAGGT AAATTTAATA AGGGGAAAAA AATGAATGAT GCTTTGTGTG
CGACATTTTT CGGTTCATAC TCCATACCGT TAGTTGCGGG TGCTTATACG CAAAGTGGTT TGATCTTGGA AGTAGGTACA
CGGGAACTTT ATTAAATTCC AGGCTCCCAG GCTCCGGGCT CCCAGCTATT TAGCGCGTAG AGACAAATAC ATAGCTGTGT
AACATTAGCA GTAGATAGAC AGGTAGCATA TCAGACACAC TGATTAAAGC ATGTTTTTAT GAACATGTTA TTAGAAATGT
CCATACGCAT AGTATCACGA AAAAGGATTT GAGTGAGCTT TAATTGATGC TCCACAAGTT CAGAAATACT TGAAATGTGA
GGTGGGTTCG TGAAAAGTTC TCTTTGCGGT TTAGAAGGTT ACAAGTAGAC ATCTTTGCTT GTGACGTTGA ACTGCTAGCT
GCTTTTGGGG ATCCCTTGAA ACATGGATTG GCCTGTTGGA TCCCACCAAC TCCTTCAGCT GCAAGTATTA AGATTTGCAC
AGACCTGTAG TTTCAATATG AAGACGTATT TGATAAAAAA ATGGACGTCC TGCTTATTGT TTGTAGCAGA CAACCTCTGC
TTCTGGACAG AAAGTAGAAA GGAAGAACAA TCTAATGTGC ATGTGCCATG TAATTCTAAT TTACCTGATA TTCCCAAAAC
GACTGTTTCA AGTTCTTTTT ACTGAAATCA GAATTTCAGA TTTAACTAAC TAATTTTCTG TACCACGTAA ACTTTGTACT
TACCTGTTTT GCTTGGCGAC TTTTACACTG TTGCACTCTT CATTCTGTTG CAAAGTTCCA AATTGTTCAT TTGGTGTTCC
TTCCACTAGA TGCAGGCATA TGCCTGATTA GTTACTACTA ATACTACAAG TTGGAATATA TTTTCTTATT CAGGAACAAT
TTGTTACTCA CGTTTATCAT CTCATAATTA CGCTCTCTGA TCAGTGGCGC ATTTGGGGAT GCAAAATTGT AATCTTATTC
CCCATCATTA TTATCCTGAA TATATTTTCG GAAAAACTAA TATTTTATTT GATCAAGATG TGTCGCTTTT AATCAGTATC
TTGAAATTTA TTAGAACGAA AGGGGGTGCC TTTTCTATTA TTGGATGTCA TTTTCCCACT GTGCAAGGCT GTAAGTTCAC
TGTTAAAGAT AATTTCATTT GATCCCCATT GTAGGACATG AAACAAACCA AAGATATTTC AACATAGTGG TTGCTTGGTC
ATGCATTTCC TTATTTGTGT CAACTCTCTC TGCATCTAGT AACTTTTGGT CAGTAATAGT TAGAAGATGC TGGCACACTT
ATGGATAAAG TACATTGCAA AGGACTGATA TTACAATTCG AGAAATAATC TTTGATGTAA GGATTGAAGT TTTGTTTACA
ATCTTTTGAG TTGGGTGGCC TGTATAACAC AAACAGTATT TCAGTTATCT CTGTCAGGAT CCCACTATGA GCTGAAGCCT
GTCTTTGTCA CCGTCCCATT GGATAGTGCC TCTTTCTTCG TAGCGCTTTA TATTGATTGG GAATTAAAAA GAAAGACTAT
TTGTGTTTTG GATCTGTTGA ATTTCTAGAA AACATATATT AGTTCCATTG CATTTTGGAT AACTTTGTTG TTTTCTGTAT
TTGATCAACA TCTAACAGAA CATTTTCATA GTGGTACCCT TTTTCCATTT TTTCAATAGT TTTACTTCAT GTTTTTACAT
TACACATGTC CACATGTTTC AATCCAATTT TTCTTCCTTT CTTATATGTT TGGAAATTGT GCTCATCAAT GCCATTTGAC
AGGAGGAAAA AATTAGGGAA ACCATCCAGG ATGTGGGCTT TGAAGCTAAG CTGATTGATG AGGAAGTCAA GGAAAAAAAC
ATTCTAGTAT GCAGGCTGCA CATAAAAGGA ATGACCTGCA CATCTTGTGC GAGCACAGTG GAATCCATCT TGCAAGTTGT
TCCTGGTGTT CAGAGAGCTT CTGTCGCATT GGCTACTGAA GAGGCAGAAA TCCGTTATGA CCGTAGAATC GTTACTGCCA
GTCAACTAAC CCATGCAGTT GAAGAGACGG GTTTTGAAGC AATACTGATC ACCACTGGAG ATGATCAGAG CAGGATAGAC
CTCAAAGTGG ATGGCACACT CAACGAGAGA TCAATCATGA TAGTGAAAAG CTCTGTCCAA GCTCTTCCTG GTGTGGAAGA
CATAAAAGTT GATCCTGAGC TCCACAAGAT CACCATCTCA TACAAACCTG ACCAGACAGG TCCTCGAGAC CTCATTGAAG
TCATTGAGTC AGCTGCCTCT GGTGATCTTA CTGTATCGAT ATACCCAGAA GCAGATGGAA GGCAGCAGCA TAGACATGGG
GAGATCAAGC GATACAGGCA GTCTTTCTTG TGGAGTTTAG TATTCACCAT CCCGGTATTC CTCACCTCCA TGGTGTTCAT
GTACATCCCA GGGCTGAAGG ATGGGCTCGA AAAGAAGGTT ATTAACATGA TGAGCATTGG TGAGCTCTTG CGGTGGATTT
TGTCAACGCC AGTTCAATTT GTAATTGGCC GCAGATTTTA TACTGGTGCT TATAAAGCGT TATCCCACGG CTCATCAAAC
ATGGATGTAC TCATTGCTCT TGGGACCAAC ACAGCTTACT TCTACTCAGT TTACTCCATC CTCCGAGCTG CCTCCTCACA
TAATTACATG GCAACTGATT TTTTTGAAAC TAGTTCAATG CTCATATCGT TTATCCTTCT TGGAAAGTAC CTTGAGATCT
TGGCAAAAGG GAAGACCTCT GAGGCTATTG CCAAGCTTAT GGATCTTGCA CCAGAAACTG CAACTATGTT GATATATGAT
CATGAAGGGA ATGTTGTGGG CGAGAAGGAA ATTGACAGTA GGTTGATTCA GAAAAATGAT GTGATCAAAG TAGTCCCAGG
TGGGAAAGTT GCTTCTGATG GCTTTGTTAT ATGGGGACAG AGCCATGTGA ATGAAAGCAT GATCACCGGA GAATCACGAC
CTGTGGCAAA GAGGAAGGGT GACACTGTCA TAGGAGGGAC GGTGAATGAG AATGGTGTGC TTCATGTCCG TGCAACATTT
GTTGGATCAG AGAGTGCCCT TGCACAGATT GTACGGCTAG TAGAGTCAGC GCAAATGGCA AAAGCTCCTG TACAAAAGTT
TGCTGATCAG ATATCTAGAG TCTTTGTTCC CCTGGTAAGT TCAGTTTCAT CGTGGTAATT CAACGGATAT CATTTCTTAT
CAATTCTAAA TAGTCTTCTT CATCCTTTCA GGTCATCATT CTTTCTTTGC TTACTTGGCT TGCTTGGTTC TTAGCTGGGA
GGCTTCATGG TTACCCTAAC TCATGGATAC CATCTTCCAT GGATAGCTTT CAACTAGCTC TCCAATTCGG GATATCAGTT
ATGGTTATTG CATGCCCTTG CGCCTTAGGG CTTGCAACTC CAACAGCTGT GATGGTTGCT ACTGGAGTTG GTGCCTCACA
AGGAGTTCTT ATCAAGGGTG GGCAAGCTCT GGAGAGTGCA CAGAAGGTCC ATAAAAAAAC ATTGTACTTT TAGATGCACA
TGTTTGCAAA CATCAAATTA TTGACAAATT TTTTATGGCA TTTATAGGTC GACTGCATCG TTTTCGACAA GACAGGGACA
CTAACCATTG GGAAGCCTGT TGTGGTCAAC ACAAGACTGT TAAAAAACAT GGTCTTGCGT GAATTCTATG CTTACGTTGC
AGCAGCAGAG GTATGCTTTC AAGCTTGCTA GATCTTTTTG ATTCAATGCC TTTATTACTT GTAGCAAAAT ATCATTCCTT
TGTGATATAT GAAAAGGTTG GTTGAGGGCA TAGATGTATG CCTAGACCCA CCCAAGTTCA AGTCCTCATC GAGGCGAATT
CGGATGCCTA TTTCTTCTTA ATTAATTAAA AATGTCACCT AGTTCCTCCT AGGTTGGTTA AGGTTCTTTT GTTGTGATTT
GTAAAAAGAA ACATTGCTCA AATTTTATCG GTTCTGGTCT TCAGGTCAAC AGTGAGCACC CACTGGGTAA GGCAGTCGTG
GAGCATGCCA AGAAGTTCCA TTCGGAAGAG AGCCATGTCT GGACTGAAGC AAGGGATTTC ATTTCAGTGA CAGGGCACGG
TGTCAAGGCA AAAATAAGTG GCAGGGCTGT TATGGTGGGA AACAAGAGCT TTATGTTGAC TTCAGGCATT GATATCCCGG
TGGAAGCTTT GGAAATCCTA ACGGAAGAAG AGGAGAAGGC CCAAACAGCG ATCATTGTGG CTATGGATCA AGAAGTCGTG
GGCATTATCT CTGTATCTGA TCCAATAAAA CCAAATGCCC GCGAAGTGAT TTCGTATCTC AAATCTATGA AGGTGGAGAG
TATAATGGTG ACTGGGGACA ACTGGGGGAC TGCCAATGCC ATTAGCAAAG AGGTTGGCAT TGAGAACACA GTTGCAGAAG
CGAAACCAGA GCAGAAAGCT GAGAAGGTGA AAGAACTTCA GGTGAGCTAT CATAAAATCT TTTGCATGTC TCCTGGTTTT
TTTTGCCGTA CCGTTATTTG GTTATTCACA CCCTCCGATT TTTTTTTACT CTTGCAGTCG GCCGGAAGGA CCGTGGCAAT
GGTTGGTGAT GGAATCAACG ATTCTCCAGC GCTTGTATCA GCCGACGTTG GCCTGGCGAT TGGCGCAGGC ACTGACGTCG
CCATTGAAGC GGCCGACATC GTCCTCATGA AGAGCAACCT GGAAGACGTG ATCACCGCCA TCGATCTGTC CAGAAAAACC
TTCTTCCGCA TACGGATGAA CTACGTCTGG GCGCTCGGCT ACAACATCAT CGGCATACCG ATCGCTGCCG GGGTGCTCTT
CCCGTCGACC CGGTTCCGCT TGCCGCCATG GGTCGCCGGC GCTGCGATGG CTGCTTCCTC CGTTAGCGTC GTCTGCTGGT
CCCTGCTGTT GAGGTACTAC AAGAGCCCAA AACTGGGCCG TTGATCATGC AGTACACACG CATAGCATTT GCTTAGAATA
AGAGGTGTAG ATATCTGTTG ACAATGTGCT AATGTGGTTC TAAAAGAAAT GTGCTAGTGT GTGTTGTGTG GCACCTGAAA
TGTGTACATT ACCTACGTAT ATATGCACCG TGTGTTTACA AGTGTT

Locus: Os04g0556000

Loading...

Locus: Os04g0556000

Loading...