Os04t0556000-02

Locus

Os04g0556000

Description

Similar to heavy metal ATPase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HMA5

CGSNL Gene Name

HEAVY METAL ATPASE 5

Oryzabase Gene Symbol Synonym(s)

OsHMA8, osHMA5, HMA8, OsHMP27, HMP27

Oryzabase Gene Name Synonym(s)

heavy metal ATPase 8, heavy metal ATPase 5, heavy metal P-Type ATPase 5, Heavy metal-associated protein 27

Transcript Evidence

AK063759 (DDBJ, Best hit)

Protein Evidence

XP_002303580.1 (RefSeq)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: ATP biosynthetic process (GO:0006754)

Biological Process: cation transport (GO:0006812)

Biological Process: metabolic process (GO:0008152)

Biological Process: metal ion transport (GO:0030001)

Biological Process: copper ion export (GO:0060003)

Cellular Component: membrane (GO:0016020)

Cellular Component: integral to membrane (GO:0016021)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: copper-exporting ATPase activity (GO:0004008)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism (GO:0015662)

Molecular Function: metal ion binding (GO:0046872)

Functional domain (InterPro)

ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter (IPR001757)

Haloacid dehalogenase-like hydrolase (IPR005834)

ATPase, P type, cation/copper-transporter (IPR006403)

ATPase, P-type, heavy metal translocating (IPR006416)

ATPase, P-type, ATPase-associated domain (IPR008250)

ATPase, P-type phosphorylation site (IPR018303)

HAD-like domain (IPR023214)

ATPase, P-type, cytoplasmic domain N (IPR023299)

ATPase, P-type, cytoplasmic transduction domain A (IPR023300)

Full-length cDNA

001-121-A10 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0556000-02)

Others

Oryzabase (13011)

Transcript

1942 bp

>Os04t0556000-02 Similar to heavy metal ATPase.
TTGAAACTAGTTCAATGCTCATATCGTTTATCCTTCTTGGAAAGTACCTTGAGATCTTGG
CAAAAGGGAAGACCTCTGAGGCTATTGCCAAGCTTATGGATCTTGCACCAGAAACTGCAA
CTATGTTGATATATGATCATGAAGGGAATGTTGTGGGCGAGAAGGAAATTGACAGTAGGT
TGATTCAGAAAAATGATGTGATCAAAGTAGTCCCAGGTGGGAAAGTTGCTTCTGATGGCT
TTGTTATATGGGGACAGAGCCATGTGAATGAAAGCATGATCACCGGAGAATCACGACCTG
TGGCAAAGAGGAAGGGTGACACTGTCATAGGAGGGACGGTGAATGAGAATGGTGTGCTTC
ATGTCCGTGCAACATTTGTTGGATCAGAGAGTGCCCTTGCACAGATTGTACGGCTAGTAG
AGTCAGCGCAAATGGCAAAAGCTCCTGTACAAAAGTTTGCTGATCAGATATCTAGAGTCT
TTGTTCCCCTGGTCATCATTCTTTCTTTGCTTACTTGGCTTGCTTGGTTCTTAGCTGGGA
GGCTTCATGGTTACCCTAACTCATGGATACCATCTTCCATGGATAGCTTTCAACTAGCTC
TCCAATTCGGGATATCAGTTATGGTTATTGCATGCCCTTGCGCCTTAGGGCTTGCAACTC
CAACAGCTGTGATGGTTGCTACTGGAGTTGGTGCCTCACAAGGAGTTCTTATCAAGGGTG
GGCAAGCTCTGGAGAGTGCACAGAAGGTCGACTGCATCGTTTTCGACAAGACAGGGACAC
TAACCATTGGGAAGCCTGTTGTGGTCAACACAAGACTGTTAAAAAACATGGTCTTGCGTG
AATTCTATGCTTACGTTGCAGCAGCAGAGGTCAACAGTGAGCACCCACTGGGTAAGGCAG
TCGTGGAGCATGCCAAGAAGTTCCATTCGGAAGAGAGCCATGTCTGGACTGAAGCAAGGG
ATTTCATTTCAGTGACAGGGCACGGTGTCAAGGCAAAAATAAGTGGCAGGGCTGTTATGG
TGGGAAACAAGAGCTTTATGTTGACTTCAGGCATTGATATCCCGGTGGAAGCTTTGGAAA
TCCTAACGGAAGAAGAGGAGAAGGCCCAAACAGCGATCATTGTGGCTATGGATCAAGAAG
TCGTGGGCATTATCTCTGTATCTGATCCAATAAAACCAAATGCCCGCGAAGTGATTTCGT
ATCTCAAATCTATGAAGGTGGAGAGTATAATGGTGACTGGGGACAACTGGGGGACTGCCA
ATGCCATTAGCAAAGAGGTTGGCATTGAGAACACAGTTGCAGAAGCGAAACCAGAGCAGA
AAGCTGAGAAGGTGAAAGAACTTCAGTCGGCCGGAAGGACCGTGGCAATGGTTGGTGATG
GAATCAACGATTCTCCAGCGCTTGTATCAGCCGACGTTGGCCTGGCGATTGGCGCAGGCA
CTGACGTCGCCATTGAAGCGGCCGACATCGTCCTCATGAAGAGCAACCTGGAAGACGTGA
TCACCGCCATCGATCTGTCCAGAAAAACCTTCTTCCGCATACGGATGAACTACGTCTGGG
CGCTCGGCTACAACATCATCGGCATACCGATCGCTGCCGGGGTGCTCTTCCCGTCGACCC
GGTTCCGCTTGCCGCCATGGGTCGCCGGCGCTGCGATGGCTGCTTCCTCCGTTAGCGTCG
TCTGCTGGTCCCTGCTGTTGAGGTACTACAAGAGCCCAAAACTGGGCCGTTGATCATGCA
GTACACACGCATAGCATTTGCTTAGAATAAGAGGTGTAGATATCTGTTGACAATGTGCTA
ATGTGGTTCTAAAAGAAATGTGCTAGTGTGTGTTGTGTGGCACCTGAAATGTGTACATTA
CCTACGTATATATGCACCGTGTGTTTACAAGTGTTAAATATGGAGCACTTTGCCAACACT
AGCAGGTGATACGTTGTAGTGC

CDS

1731 bp

>Os04t0556000-02 Similar to heavy metal ATPase.
GAAACTAGTTCAATGCTCATATCGTTTATCCTTCTTGGAAAGTACCTTGAGATCTTGGCA
AAAGGGAAGACCTCTGAGGCTATTGCCAAGCTTATGGATCTTGCACCAGAAACTGCAACT
ATGTTGATATATGATCATGAAGGGAATGTTGTGGGCGAGAAGGAAATTGACAGTAGGTTG
ATTCAGAAAAATGATGTGATCAAAGTAGTCCCAGGTGGGAAAGTTGCTTCTGATGGCTTT
GTTATATGGGGACAGAGCCATGTGAATGAAAGCATGATCACCGGAGAATCACGACCTGTG
GCAAAGAGGAAGGGTGACACTGTCATAGGAGGGACGGTGAATGAGAATGGTGTGCTTCAT
GTCCGTGCAACATTTGTTGGATCAGAGAGTGCCCTTGCACAGATTGTACGGCTAGTAGAG
TCAGCGCAAATGGCAAAAGCTCCTGTACAAAAGTTTGCTGATCAGATATCTAGAGTCTTT
GTTCCCCTGGTCATCATTCTTTCTTTGCTTACTTGGCTTGCTTGGTTCTTAGCTGGGAGG
CTTCATGGTTACCCTAACTCATGGATACCATCTTCCATGGATAGCTTTCAACTAGCTCTC
CAATTCGGGATATCAGTTATGGTTATTGCATGCCCTTGCGCCTTAGGGCTTGCAACTCCA
ACAGCTGTGATGGTTGCTACTGGAGTTGGTGCCTCACAAGGAGTTCTTATCAAGGGTGGG
CAAGCTCTGGAGAGTGCACAGAAGGTCGACTGCATCGTTTTCGACAAGACAGGGACACTA
ACCATTGGGAAGCCTGTTGTGGTCAACACAAGACTGTTAAAAAACATGGTCTTGCGTGAA
TTCTATGCTTACGTTGCAGCAGCAGAGGTCAACAGTGAGCACCCACTGGGTAAGGCAGTC
GTGGAGCATGCCAAGAAGTTCCATTCGGAAGAGAGCCATGTCTGGACTGAAGCAAGGGAT
TTCATTTCAGTGACAGGGCACGGTGTCAAGGCAAAAATAAGTGGCAGGGCTGTTATGGTG
GGAAACAAGAGCTTTATGTTGACTTCAGGCATTGATATCCCGGTGGAAGCTTTGGAAATC
CTAACGGAAGAAGAGGAGAAGGCCCAAACAGCGATCATTGTGGCTATGGATCAAGAAGTC
GTGGGCATTATCTCTGTATCTGATCCAATAAAACCAAATGCCCGCGAAGTGATTTCGTAT
CTCAAATCTATGAAGGTGGAGAGTATAATGGTGACTGGGGACAACTGGGGGACTGCCAAT
GCCATTAGCAAAGAGGTTGGCATTGAGAACACAGTTGCAGAAGCGAAACCAGAGCAGAAA
GCTGAGAAGGTGAAAGAACTTCAGTCGGCCGGAAGGACCGTGGCAATGGTTGGTGATGGA
ATCAACGATTCTCCAGCGCTTGTATCAGCCGACGTTGGCCTGGCGATTGGCGCAGGCACT
GACGTCGCCATTGAAGCGGCCGACATCGTCCTCATGAAGAGCAACCTGGAAGACGTGATC
ACCGCCATCGATCTGTCCAGAAAAACCTTCTTCCGCATACGGATGAACTACGTCTGGGCG
CTCGGCTACAACATCATCGGCATACCGATCGCTGCCGGGGTGCTCTTCCCGTCGACCCGG
TTCCGCTTGCCGCCATGGGTCGCCGGCGCTGCGATGGCTGCTTCCTCCGTTAGCGTCGTC
TGCTGGTCCCTGCTGTTGAGGTACTACAAGAGCCCAAAACTGGGCCGTTGA

Protein

577 aa

>Os04t0556000-02 Similar to heavy metal ATPase.
ETSSMLISFILLGKYLEILAKGKTSEAIAKLMDLAPETATMLIYDHEGNVVGEKEIDSRL
IQKNDVIKVVPGGKVASDGFVIWGQSHVNESMITGESRPVAKRKGDTVIGGTVNENGVLH
VRATFVGSESALAQIVRLVESAQMAKAPVQKFADQISRVFVPLVIILSLLTWLAWFLAGR
LHGYPNSWIPSSMDSFQLALQFGISVMVIACPCALGLATPTAVMVATGVGASQGVLIKGG
QALESAQKVDCIVFDKTGTLTIGKPVVVNTRLLKNMVLREFYAYVAAAEVNSEHPLGKAV
VEHAKKFHSEESHVWTEARDFISVTGHGVKAKISGRAVMVGNKSFMLTSGIDIPVEALEI
LTEEEEKAQTAIIVAMDQEVVGIISVSDPIKPNAREVISYLKSMKVESIMVTGDNWGTAN
AISKEVGIENTVAEAKPEQKAEKVKELQSAGRTVAMVGDGINDSPALVSADVGLAIGAGT
DVAIEAADIVLMKSNLEDVITAIDLSRKTFFRIRMNYVWALGYNIIGIPIAAGVLFPSTR
FRLPPWVAGAAMAASSVSVVCWSLLLRYYKSPKLGR*

5'UTR

chr04:27833064..27833065 (+ strand) : 2 bp

CDS

chr04:27833066..27833554 (+ strand) : 489 bp

chr04:27833632..27833886 (+ strand) : 255 bp

chr04:27833968..27834090 (+ strand) : 123 bp

chr04:27834365..27834841 (+ strand) : 477 bp

chr04:27834938..27835324 (+ strand) : 387 bp

3'UTR

chr04:27835325..27835533 (+ strand) : 209 bp

FASTA

>Os04t0556000-02 class=Sequence position=chr04:27833064..27835533 (+ strand)
TTGAAACTAG TTCAATGCTC ATATCGTTTA TCCTTCTTGG AAAGTACCTT GAGATCTTGG CAAAAGGGAA GACCTCTGAG
GCTATTGCCA AGCTTATGGA TCTTGCACCA GAAACTGCAA CTATGTTGAT ATATGATCAT GAAGGGAATG TTGTGGGCGA
GAAGGAAATT GACAGTAGGT TGATTCAGAA AAATGATGTG ATCAAAGTAG TCCCAGGTGG GAAAGTTGCT TCTGATGGCT
TTGTTATATG GGGACAGAGC CATGTGAATG AAAGCATGAT CACCGGAGAA TCACGACCTG TGGCAAAGAG GAAGGGTGAC
ACTGTCATAG GAGGGACGGT GAATGAGAAT GGTGTGCTTC ATGTCCGTGC AACATTTGTT GGATCAGAGA GTGCCCTTGC
ACAGATTGTA CGGCTAGTAG AGTCAGCGCA AATGGCAAAA GCTCCTGTAC AAAAGTTTGC TGATCAGATA TCTAGAGTCT
TTGTTCCCCT GGTAAGTTCA GTTTCATCGT GGTAATTCAA CGGATATCAT TTCTTATCAA TTCTAAATAG TCTTCTTCAT
CCTTTCAGGT CATCATTCTT TCTTTGCTTA CTTGGCTTGC TTGGTTCTTA GCTGGGAGGC TTCATGGTTA CCCTAACTCA
TGGATACCAT CTTCCATGGA TAGCTTTCAA CTAGCTCTCC AATTCGGGAT ATCAGTTATG GTTATTGCAT GCCCTTGCGC
CTTAGGGCTT GCAACTCCAA CAGCTGTGAT GGTTGCTACT GGAGTTGGTG CCTCACAAGG AGTTCTTATC AAGGGTGGGC
AAGCTCTGGA GAGTGCACAG AAGGTCCATA AAAAAACATT GTACTTTTAG ATGCACATGT TTGCAAACAT CAAATTATTG
ACAAATTTTT TATGGCATTT ATAGGTCGAC TGCATCGTTT TCGACAAGAC AGGGACACTA ACCATTGGGA AGCCTGTTGT
GGTCAACACA AGACTGTTAA AAAACATGGT CTTGCGTGAA TTCTATGCTT ACGTTGCAGC AGCAGAGGTA TGCTTTCAAG
CTTGCTAGAT CTTTTTGATT CAATGCCTTT ATTACTTGTA GCAAAATATC ATTCCTTTGT GATATATGAA AAGGTTGGTT
GAGGGCATAG ATGTATGCCT AGACCCACCC AAGTTCAAGT CCTCATCGAG GCGAATTCGG ATGCCTATTT CTTCTTAATT
AATTAAAAAT GTCACCTAGT TCCTCCTAGG TTGGTTAAGG TTCTTTTGTT GTGATTTGTA AAAAGAAACA TTGCTCAAAT
TTTATCGGTT CTGGTCTTCA GGTCAACAGT GAGCACCCAC TGGGTAAGGC AGTCGTGGAG CATGCCAAGA AGTTCCATTC
GGAAGAGAGC CATGTCTGGA CTGAAGCAAG GGATTTCATT TCAGTGACAG GGCACGGTGT CAAGGCAAAA ATAAGTGGCA
GGGCTGTTAT GGTGGGAAAC AAGAGCTTTA TGTTGACTTC AGGCATTGAT ATCCCGGTGG AAGCTTTGGA AATCCTAACG
GAAGAAGAGG AGAAGGCCCA AACAGCGATC ATTGTGGCTA TGGATCAAGA AGTCGTGGGC ATTATCTCTG TATCTGATCC
AATAAAACCA AATGCCCGCG AAGTGATTTC GTATCTCAAA TCTATGAAGG TGGAGAGTAT AATGGTGACT GGGGACAACT
GGGGGACTGC CAATGCCATT AGCAAAGAGG TTGGCATTGA GAACACAGTT GCAGAAGCGA AACCAGAGCA GAAAGCTGAG
AAGGTGAAAG AACTTCAGGT GAGCTATCAT AAAATCTTTT GCATGTCTCC TGGTTTTTTT TGCCGTACCG TTATTTGGTT
ATTCACACCC TCCGATTTTT TTTTACTCTT GCAGTCGGCC GGAAGGACCG TGGCAATGGT TGGTGATGGA ATCAACGATT
CTCCAGCGCT TGTATCAGCC GACGTTGGCC TGGCGATTGG CGCAGGCACT GACGTCGCCA TTGAAGCGGC CGACATCGTC
CTCATGAAGA GCAACCTGGA AGACGTGATC ACCGCCATCG ATCTGTCCAG AAAAACCTTC TTCCGCATAC GGATGAACTA
CGTCTGGGCG CTCGGCTACA ACATCATCGG CATACCGATC GCTGCCGGGG TGCTCTTCCC GTCGACCCGG TTCCGCTTGC
CGCCATGGGT CGCCGGCGCT GCGATGGCTG CTTCCTCCGT TAGCGTCGTC TGCTGGTCCC TGCTGTTGAG GTACTACAAG
AGCCCAAAAC TGGGCCGTTG ATCATGCAGT ACACACGCAT AGCATTTGCT TAGAATAAGA GGTGTAGATA TCTGTTGACA
ATGTGCTAAT GTGGTTCTAA AAGAAATGTG CTAGTGTGTG TTGTGTGGCA CCTGAAATGT GTACATTACC TACGTATATA
TGCACCGTGT GTTTACAAGT GTTAAATATG GAGCACTTTG CCAACACTAG CAGGTGATAC GTTGTAGTGC 

Locus: Os04g0556000

Loading...

Locus: Os04g0556000

Loading...