Os04t0569100-01

Locus

Os04g0569100

Description

Similar to OCL1 homeobox protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ROC4

CGSNL Gene Name

RICE OUTMOST CELL-SPECIFIC GENE 4

Oryzabase Gene Symbol Synonym(s)

Roc4(t), Roc4, GL2-4, OsROC4, OsGL2-4

Oryzabase Gene Name Synonym(s)

Rice outmost cell-specific gene 4(t), Rice outermost cell-specific gene-4, Homeobox-leucine zipper protein ROC4, Homeodomain transcription factor ROC4, HD-ZIP protein ROC4, Protein RICE OUTERMOST CELL-SPECIFIC 4, GLABRA 2-like homeobox protein 4

Transcript Evidence

AK112099 (DDBJ, Best hit)

AK111914 (DDBJ, Best hit)

Protein Evidence

Q7Y0V9-2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: transcription regulatory region sequence-specific DNA binding (GO:0000976)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: protein binding (GO:0005515)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Helix-turn-helix motif, lambda-like repressor (IPR000047)

Homeobox (IPR001356)

Lipid-binding START (IPR002913)

Homeodomain-like (IPR009057)

Homeodomain-related (IPR012287)

Homeobox, conserved site (IPR017970)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Full-length cDNA

002-108-E06 (Online Clone Ordering)

J033128F17 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0569100-01)

Others

Oryzabase (2865)

Transcript

3088 bp

>Os04t0569100-01 Similar to OCL1 homeobox protein.
GCACGCACTGCTGCTGCTGCTCGCTCTCGCTTTGCTTCCCCTAATCTTCTCCCGGGCCAG
GGGGGAAGAGGGGCGGAATTCGGGCACGAGCTTTGGAGTTGGAGATCACTTCGGCGACGG
CGTGGTCCCCGCCGGCATGCAGTTCCCGTTCTCCGGCGCTGGCCCGGGCGTCTTCACGTC
ATCGCCGGCGCTCTCCCTCGCGCTGGCGGACGCGGTGGCAGGCCGGAACAGCGGCGGCGG
TGGGAAGATGGTTACCGCGGCCCATGGCGGCGTCGGCGGAGGAGGAGGAGGAGGACGCGC
GAAGGCGAGGGACGCGTTGGAGGTGGAGAACGAGATGAGCCGGTCCGGGAGCGACCACCT
CGACGTCGTCTCTTGCGGCGAcgcgggcggcggcggcggcgacgacgacgatgacgagga
cgccgagcacggcaacccgcccaagcgcaagaagcggtacCACCGCCACACGCCGCAGCA
GATCCAAGAGCTGGAAGCGATGTTCAAGGAATGCCCCCACCCAGACGAGAAGCAGCGCGC
CGAGCTGAGCAAGCGGCTCGGCCTCGAACCCCGGCAGGTCAAGTTCTGGTTCCAGAATCG
GCGAACGCAGATGAAGATGCAACTGGAGCGACACGAGAACTCGCTGCTGAAGCAGGAGAA
CGATAAGCTGCGGTCCGAGAACCTGTCAATCCGGGAGGCCACGAGCAACGCGGTGTGCGT
TGGCTGCGGCGGCCCGGCGATGCTCGGGGAGGTGTCCCTGGAGGAGCACCACCTTCGCGT
CGAGAACGCGAGGCTCAAGGACGAGCTCAGCCGAGTGTGCGCGCTCGCCGCCAAGTTCCT
TGGCAAGTCCATCTCTGTCATGGCGCCACCGCAGATGCATCAGCCTCAtcctgtgccagg
ctcgtcgctggagcttgcggttgggggtatcggttcgatgccatcagccacgatgcccat
ctcgacgatcactgattttgctggcgccatgtccagttcaatgggcacggtgatcacgcc
catgaagtctgaggctgaaccatcggcaatggctggcattgacaagtccttgttcttgga
gctagcaatgagtgcaatggatgagctagtcaagatggctcagatgggggatccgctatg
gattccaggtgcctccgtaccttcctcgccggcaaaggagagtctaaacttcgaggagta
cctaaacaccttcccaccttgcatcggggtgaagcctgaagggtatgtatcagaggcatc
tagagaatctggcattgtcatcattgacgatggcgccgcgcttgtggagaccctcatgga
tgagCGACGGTGGTCCGATATGTTCTCATGCATGATTGCCAAGGCATCAACCACTGAGGA
GATTTCTACTGGTGTTGCTGGGAGTAGAAATGGTGCATTGCTTCTTATGCAGGCAGAGCT
ACAGGTGCTTTCTCCTCTTGTGCCTATTAGAGAGGTGAAGTTTCTCAGGTTCTCCAAACA
GCTGGCTGATGGTGTATGGGCTGTAGTGGACGTTTCGGCTGATGAATTGATGAGGGATCA
GGGCATTACTTCTGCATCCTCGACTGCAAACATGAACTGCCGAAGGCTGCCTTCTGGTTG
TGTGCTGCAGGACACTCCAAATGGGTTTGTTAAGGTCACATGGGTTGAACATACAGAATA
TGATGAGGCATCTGTGCACCCGCTCTACCGGCCTCTTCTCCGGTCTGGTCTTGCCCTTGG
TGCAGGGCGATGGATCGCGACATTACAGCGGCAGTGCGAATGCTTGGCCCTTCTCATGTC
TTCTATTGCATTGCCAGAGAACGACTCATCAGCTATCCATCCTGAAGGTAAACGGAGCAT
GTTGAAGTTGGCAAGGAGGATGACGGACAACTTCTGTGCAGGGGTGAGCACATCATCTAC
CCGTGAATGGAGCAAACTGGTTGGATTGACAGGCAACATTGGGGAGGATGTGCATGTAAT
GGCGCGGAAGAGTGTGGATGAACCTGGAACGCCGCCAGGTGTGGTGCTTAGTGCTGCTAC
ATCTGTGTGGATGCCTGTGATGCCTGAACGGCTCTTCAACTTCTTGCACAACAAGGGGCT
GCGTGCTGAATGGGATATCCTCAGCAATGGTGGCCCTATGCAGGAGGTGACAAGCATTGC
CAAGGGGCAACAGAATGGCAATACCGTATGTCTACTGAAGGCTAGTCCCACCAAAGACAA
GCAGAACAGCATGCTGATCCTACAGGAGACGTGTGCAGACGCATCCGGTTCAATGGTTGT
GTATGCTCCTGTAGACATCCCAGCAATGCACCTTGTCATGAGTGGTGGGGATTCGTCATG
CGTCGCCCTTCTTCCATCAGGTTTTGCCATCCTGCCTGCTGGGCCTAGCATCGGCGCAGA
TCACAAGATGGGCGGTTCATTGCTCACCGTTGCATTCCAGATACTTGCCAACAGCCAGCC
CAGTGCTAAGCTCACGGTGGAGTCAGTCGAGACCGTGAGCAACCTTATCTCCTGCACCAT
CAAGAAGATCAAGACGGCGCTGCATTGCGACGTGTGAACCCAACAAGGGGGGACTTTTGG
CCTAGTGGGAGCGGCTGTGGCGATGAGCCTGAGTCAAGAACGAACCGCGACATAGGAAGG
GACCTTTGCTAGGTGGCAAGGACCGGACGGGGCAGGTCCTTAGCACAGAGCAATGGTGGT
GGTTCGGGTATTGACTCAGCCTCTCCCGCCTCCGTTCTCTCCTGTGACTGGTGCATGTTG
AAGTGAACCTGCATTTTGGACGCCATGTAGCAGGCCATCTTTCTTTCTTTTTCCTTTTTC
TTTTTCTTTTTCTTTTTTTAGGGAGAAGGGAGTCATCTGTGTTTTTTGTTGGCTGGCTCA
GGGTGTTGGTGTTTCTGGTTTCTAGCTTTTGTTACAGGGAGATGTGATACATTTTGTAGA
AGCTCCGAATTGTCGTGCTGGTATGTGAGGTTCTGATCATAGGTCTGTGTTTGATAGTCT
CGAGCTATCAACGCCTGGCAAATGCAAACCTTGTTATGCTAAAATATGTTTTAGATCAAT
CTGATTCTGAAAGCTGTTTACATGTCCC

CDS

2421 bp

>Os04t0569100-01 Similar to OCL1 homeobox protein.
ATGCAGTTCCCGTTCTCCGGCGCTGGCCCGGGCGTCTTCACGTCATCGCCGGCGCTCTCC
CTCGCGCTGGCGGACGCGGTGGCAGGCCGGAACAGCGGCGGCGGTGGGAAGATGGTTACC
GCGGCCCATGGCGGCGTCGGCGGAGGAGGAGGAGGAGGACGCGCGAAGGCGAGGGACGCG
TTGGAGGTGGAGAACGAGATGAGCCGGTCCGGGAGCGACCACCTCGACGTCGTCTCTTGC
GGCGAcgcgggcggcggcggcggcgacgacgacgatgacgaggacgccgagcacggcaac
ccgcccaagcgcaagaagcggtacCACCGCCACACGCCGCAGCAGATCCAAGAGCTGGAA
GCGATGTTCAAGGAATGCCCCCACCCAGACGAGAAGCAGCGCGCCGAGCTGAGCAAGCGG
CTCGGCCTCGAACCCCGGCAGGTCAAGTTCTGGTTCCAGAATCGGCGAACGCAGATGAAG
ATGCAACTGGAGCGACACGAGAACTCGCTGCTGAAGCAGGAGAACGATAAGCTGCGGTCC
GAGAACCTGTCAATCCGGGAGGCCACGAGCAACGCGGTGTGCGTTGGCTGCGGCGGCCCG
GCGATGCTCGGGGAGGTGTCCCTGGAGGAGCACCACCTTCGCGTCGAGAACGCGAGGCTC
AAGGACGAGCTCAGCCGAGTGTGCGCGCTCGCCGCCAAGTTCCTTGGCAAGTCCATCTCT
GTCATGGCGCCACCGCAGATGCATCAGCCTCAtcctgtgccaggctcgtcgctggagctt
gcggttgggggtatcggttcgatgccatcagccacgatgcccatctcgacgatcactgat
tttgctggcgccatgtccagttcaatgggcacggtgatcacgcccatgaagtctgaggct
gaaccatcggcaatggctggcattgacaagtccttgttcttggagctagcaatgagtgca
atggatgagctagtcaagatggctcagatgggggatccgctatggattccaggtgcctcc
gtaccttcctcgccggcaaaggagagtctaaacttcgaggagtacctaaacaccttccca
ccttgcatcggggtgaagcctgaagggtatgtatcagaggcatctagagaatctggcatt
gtcatcattgacgatggcgccgcgcttgtggagaccctcatggatgagCGACGGTGGTCC
GATATGTTCTCATGCATGATTGCCAAGGCATCAACCACTGAGGAGATTTCTACTGGTGTT
GCTGGGAGTAGAAATGGTGCATTGCTTCTTATGCAGGCAGAGCTACAGGTGCTTTCTCCT
CTTGTGCCTATTAGAGAGGTGAAGTTTCTCAGGTTCTCCAAACAGCTGGCTGATGGTGTA
TGGGCTGTAGTGGACGTTTCGGCTGATGAATTGATGAGGGATCAGGGCATTACTTCTGCA
TCCTCGACTGCAAACATGAACTGCCGAAGGCTGCCTTCTGGTTGTGTGCTGCAGGACACT
CCAAATGGGTTTGTTAAGGTCACATGGGTTGAACATACAGAATATGATGAGGCATCTGTG
CACCCGCTCTACCGGCCTCTTCTCCGGTCTGGTCTTGCCCTTGGTGCAGGGCGATGGATC
GCGACATTACAGCGGCAGTGCGAATGCTTGGCCCTTCTCATGTCTTCTATTGCATTGCCA
GAGAACGACTCATCAGCTATCCATCCTGAAGGTAAACGGAGCATGTTGAAGTTGGCAAGG
AGGATGACGGACAACTTCTGTGCAGGGGTGAGCACATCATCTACCCGTGAATGGAGCAAA
CTGGTTGGATTGACAGGCAACATTGGGGAGGATGTGCATGTAATGGCGCGGAAGAGTGTG
GATGAACCTGGAACGCCGCCAGGTGTGGTGCTTAGTGCTGCTACATCTGTGTGGATGCCT
GTGATGCCTGAACGGCTCTTCAACTTCTTGCACAACAAGGGGCTGCGTGCTGAATGGGAT
ATCCTCAGCAATGGTGGCCCTATGCAGGAGGTGACAAGCATTGCCAAGGGGCAACAGAAT
GGCAATACCGTATGTCTACTGAAGGCTAGTCCCACCAAAGACAAGCAGAACAGCATGCTG
ATCCTACAGGAGACGTGTGCAGACGCATCCGGTTCAATGGTTGTGTATGCTCCTGTAGAC
ATCCCAGCAATGCACCTTGTCATGAGTGGTGGGGATTCGTCATGCGTCGCCCTTCTTCCA
TCAGGTTTTGCCATCCTGCCTGCTGGGCCTAGCATCGGCGCAGATCACAAGATGGGCGGT
TCATTGCTCACCGTTGCATTCCAGATACTTGCCAACAGCCAGCCCAGTGCTAAGCTCACG
GTGGAGTCAGTCGAGACCGTGAGCAACCTTATCTCCTGCACCATCAAGAAGATCAAGACG
GCGCTGCATTGCGACGTGTGA

Protein

807 aa

>Os04t0569100-01 Similar to OCL1 homeobox protein.
MQFPFSGAGPGVFTSSPALSLALADAVAGRNSGGGGKMVTAAHGGVGGGGGGGRAKARDA
LEVENEMSRSGSDHLDVVSCGDAGGGGGDDDDDEDAEHGNPPKRKKRYHRHTPQQIQELE
AMFKECPHPDEKQRAELSKRLGLEPRQVKFWFQNRRTQMKMQLERHENSLLKQENDKLRS
ENLSIREATSNAVCVGCGGPAMLGEVSLEEHHLRVENARLKDELSRVCALAAKFLGKSIS
VMAPPQMHQPHPVPGSSLELAVGGIGSMPSATMPISTITDFAGAMSSSMGTVITPMKSEA
EPSAMAGIDKSLFLELAMSAMDELVKMAQMGDPLWIPGASVPSSPAKESLNFEEYLNTFP
PCIGVKPEGYVSEASRESGIVIIDDGAALVETLMDERRWSDMFSCMIAKASTTEEISTGV
AGSRNGALLLMQAELQVLSPLVPIREVKFLRFSKQLADGVWAVVDVSADELMRDQGITSA
SSTANMNCRRLPSGCVLQDTPNGFVKVTWVEHTEYDEASVHPLYRPLLRSGLALGAGRWI
ATLQRQCECLALLMSSIALPENDSSAIHPEGKRSMLKLARRMTDNFCAGVSTSSTREWSK
LVGLTGNIGEDVHVMARKSVDEPGTPPGVVLSAATSVWMPVMPERLFNFLHNKGLRAEWD
ILSNGGPMQEVTSIAKGQQNGNTVCLLKASPTKDKQNSMLILQETCADASGSMVVYAPVD
IPAMHLVMSGGDSSCVALLPSGFAILPAGPSIGADHKMGGSLLTVAFQILANSQPSAKLT
VESVETVSNLISCTIKKIKTALHCDV*

5'UTR

chr04:28606903..28607038 (- strand) : 136 bp

CDS

chr04:28606834..28606902 (- strand) : 69 bp

chr04:28606419..28606711 (- strand) : 293 bp

chr04:28606204..28606321 (- strand) : 118 bp

chr04:28605379..28606086 (- strand) : 708 bp

chr04:28605193..28605294 (- strand) : 102 bp

chr04:28604867..28605094 (- strand) : 228 bp

chr04:28602995..28603172 (- strand) : 178 bp

chr04:28602548..28602921 (- strand) : 374 bp

chr04:28601230..28601580 (- strand) : 351 bp

3'UTR

chr04:28600699..28601229 (- strand) : 531 bp

FASTA

>Os04t0569100-01 class=Sequence position=chr04:28600699..28607038 (- strand)
GCACGCACTG CTGCTGCTGC TCGCTCTCGC TTTGCTTCCC CTAATCTTCT CCCGGGCCAG GGGGGAAGAG GGGCGGAATT
CGGGCACGAG CTTTGGAGTT GGAGATCACT TCGGCGACGG CGTGGTCCCC GCCGGCATGC AGTTCCCGTT CTCCGGCGCT
GGCCCGGGCG TCTTCACGTC ATCGCCGGCG CTCTCCCTCG CGCTGGTACG CGCGCCTTCT TCGCTGACGT GTTGGGGGGT
TTTTGTTTCT TTTTTTTTTT TGGTGGTGAT ACGGTCGAGT GATTCGGAAA GGCGCGTCTT TTCTTTGGTT GGTTCGGTTT
GTCGCAGGCG GACGCGGTGG CAGGCCGGAA CAGCGGCGGC GGTGGGAAGA TGGTTACCGC GGCCCATGGC GGCGTCGGCG
GAGGAGGAGG AGGAGGACGC GCGAAGGCGA GGGACGCGTT GGAGGTGGAG AACGAGATGA GCCGGTCCGG GAGCGACCAC
CTCGACGTCG TCTCTTGCGG CGAcgcgggc ggcggcggcg gcgacgacga cgatgacgag gacgccgagc acggcaaccc
gcccaagcgc aagaagcggt acCACCGCCA CACGCCGCAG CAGATCCAAG AGCTGGAAGC GTAAGCGCGC CCCCACCCAC
GAACAACGAT TCGTTGCATT CTCCTGTGCT TGGCTGCTTG CTTTGGCTCA TGCATGGATA CTGGCTCATC GGTGCAGGAT
GTTCAAGGAA TGCCCCCACC CAGACGAGAA GCAGCGCGCC GAGCTGAGCA AGCGGCTCGG CCTCGAACCC CGGCAGGTCA
AGTTCTGGTT CCAGAATCGG CGAACGCAGA TGAAGGTAAG CGATCGAAAC GAACAGCAAA CCATCTTTGC ACTCCGATCG
ATGGTGCAGT GCAGTTCTTG ACACTGTGTG TGTGTGTGTC TCTCTCTCCC TGTGGTGATT GAATTGGCAA AGATGCAACT
GGAGCGACAC GAGAACTCGC TGCTGAAGCA GGAGAACGAT AAGCTGCGGT CCGAGAACCT GTCAATCCGG GAGGCCACGA
GCAACGCGGT GTGCGTTGGC TGCGGCGGCC CGGCGATGCT CGGGGAGGTG TCCCTGGAGG AGCACCACCT TCGCGTCGAG
AACGCGAGGC TCAAGGACGA GCTCAGCCGA GTGTGCGCGC TCGCCGCCAA GTTCCTTGGC AAGTCCATCT CTGTCATGGC
GCCACCGCAG ATGCATCAGC CTCAtcctgt gccaggctcg tcgctggagc ttgcggttgg gggtatcggt tcgatgccat
cagccacgat gcccatctcg acgatcactg attttgctgg cgccatgtcc agttcaatgg gcacggtgat cacgcccatg
aagtctgagg ctgaaccatc ggcaatggct ggcattgaca agtccttgtt cttggagcta gcaatgagtg caatggatga
gctagtcaag atggctcaga tgggggatcc gctatggatt ccaggtgcct ccgtaccttc ctcgccggca aaggagagtc
taaacttcga ggagtaccta aacaccttcc caccttgcat cggggtgaag cctgaagggt atgtatcaga ggcatctaga
gaatctggca ttgtcatcat tgacgatggc gccgcgcttg tggagaccct catggatgag GTTGTGCTTG TGCCACCTTA
CCCCCTTTCA TGTTTCTGTT GCTTGTTTGT TTGGACTCAC CTGTAGTTTG AATTCTTGCG ACAGCGACGG TGGTCCGATA
TGTTCTCATG CATGATTGCC AAGGCATCAA CCACTGAGGA GATTTCTACT GGTGTTGCTG GGAGTAGAAA TGGTGCATTG
CTTCTTGTGA GTGATGAACA TTCTGTTGTG GCCATCCCAT GAGTTTCATG TGGTTAATCA TACTAGCATA ACCCCTGAAT
GGTAAATTTC GATCATTGCA ACAGATGCAG GCAGAGCTAC AGGTGCTTTC TCCTCTTGTG CCTATTAGAG AGGTGAAGTT
TCTCAGGTTC TCCAAACAGC TGGCTGATGG TGTATGGGCT GTAGTGGACG TTTCGGCTGA TGAATTGATG AGGGATCAGG
GCATTACTTC TGCATCCTCG ACTGCAAACA TGAACTGCCG AAGGCTGCCT TCTGGTTGTG TGCTGCAGGA CACTCCAAAT
GGGTTTGTTA AGGTACTGAG ACTGATTATC TTTGTTAGCT CCTGCTCCTT AGATATTCTT AGGTAAATGT CTTAAACCGT
GATATCCTTG ACTAGTTCAC TTCAGGGTAG TATGTGGTTT TACATCTATT AATTCACACT AGTCAGCATG CTATCGGTTG
ACGTGAAACT CATCTACCTT GCAAAGTCGC AGCTCGGTAG TACCCACGAC GCTGCCACTA GAAGTCTGTC AAAACCAGCC
ATATTAGTTG CAAAGCTTGT TAGCTCTACT CATATGATAA TCATACATAT GGAGAGTGCT TTATTAGTTC AGGCTCTCTG
CAACTAACAT GACACTCATG GAAAAGAGTA TTCGTGTATT CTTTCGTAAT GTTTCAAATA ATGTATGTTA GTTTAATGTG
TCATCTGGTG ATCACCATGC AATATTTTGT TCGTATTCAC AAGTCATGGC GTAGGCTCAT GTCTCCTATA GATATGTTGT
GGTTATGAGT CCATAATCCG AAGTAAAGTA TTGTATTGGT CAGCGGGGAG GGGAGTAAAT AAATGATTTA GGAATACTTA
AGTGGTTCTG AGATCCAACA CTTTTCCCCA AGTACGCTCC CTTGCTTTTG TTTAGTCCTG AGTTCAGTTC TCCTAGGGGA
TTAGATACTT CTTCTACTCC TGGGATGGTG CCCCTTGGGT AACTTCTTGT CCGCAGTTTA ATCGATGCGT CTCCTCGTTG
AAATCTTGAC TGCTTCCTCT ATTGTTTTGT CTCAATGTAA AAGTCCTCTT CACCTTGGGT TTTGTACCAG AGTTTTATAT
AGCCTTGATC CAAATTGCTC TGGGGCGCAC ACATGCACGA ACGATTCTAT TCAAAATTCT AAATTGGACA TCTGAATGGG
ACAAATATAT CTAGTCTACA ATGGTAGAAA CATGATTTGA TGAGTTATAA CGTCTCATTA CTATAGATTA CACTGTATAA
GTTAATCTGA TGTAAACCCA CAGGTTGAAA GCAGGAAGTG GTTCTTTATT TTAAGGGTTC AGGAACACAA TATTTTGGAA
CACTAGTGGT GTGCCATTCT TGGGGCATAC CATAAGTCAA AATAATTAAC GATGAAGATA CTGTGATCAG AACCATGCTT
TATAAAATGT AAACAAAGTC AATCTCAGAC AGATCAGCTA ATCCTAGATC AAACTAGAGA TACTGTCGTC TCTCAAGATT
TCTACTTTTC TTCTGTAATT TCATTTATGT GCTTTTGGTG CTTTTACAGT ATTTAGTTCA AATATCAGTA TTTTCTGAAG
TCTATAATCT CTCTATTGAT CAGTTTCTGG ATCTGCCTCC TGCTTTCATG GTACTTCTAT GGTTTATTCT ATGCAAAACA
GAATAGACAA ATGTGTAACT ATTATCCATT AGTCCTATGG CCTATGGTTC TCTTACAAAG TACTAGTTAC AATGCTGGGG
CCCCACTATG GGCTAATATT TCGAGGTAGC CTCTATTTTA AAACATTGTG TTGATGTCCT TTTTATGTTC CATTGATTGG
GCAAAAAGAA ATTAAAAAAA AACTTAGATG GAAAAATAAT ATTAATTGTA CCATTCAGCT TGTGTAGTAG TTGCGTACTC
CAGGAAAACT GCACCTCAGG CCTCTTTTGG TGTATTACCT CTCAAGACAT TTGCATTTTG TGCGTGCATT TAAGTCCTAA
CAGCAGATCT TGAATGGACG CTGTAGGTCA CATGGGTTGA ACATACAGAA TATGATGAGG CATCTGTGCA CCCGCTCTAC
CGGCCTCTTC TCCGGTCTGG TCTTGCCCTT GGTGCAGGGC GATGGATCGC GACATTACAG CGGCAGTGCG AATGCTTGGC
CCTTCTCATG TCTTCTATTG CATTGCCAGA GAACGACTCA TCAGGTAAAG AAATTCAATA CTACTGCTAA CTTTCAATTG
GATCCACCCT TCTAATAAAG TGCTACATTT GCAACAGCTA TCCATCCTGA AGGTAAACGG AGCATGTTGA AGTTGGCAAG
GAGGATGACG GACAACTTCT GTGCAGGGGT GAGCACATCA TCTACCCGTG AATGGAGCAA ACTGGTTGGA TTGACAGGCA
ACATTGGGGA GGATGTGCAT GTAATGGCGC GGAAGAGTGT GGATGAACCT GGAACGCCGC CAGGTGTGGT GCTTAGTGCT
GCTACATCTG TGTGGATGCC TGTGATGCCT GAACGGCTCT TCAACTTCTT GCACAACAAG GGGCTGCGTG CTGAATGGGA
TATCCTCAGC AATGGTGGCC CTATGCAGGA GGTGACAAGC ATTGCCAAGG GGCAACAGAA TGGCAATACC GTATGTCTAC
TGAAGGCTAG TGTGAGTATT AGCTAACAGT CTGCCACAGT TCTGTTCATA GCTTGCTACT TACTAAACAG CATCATTAAC
TGACTTGTGG GGGAGACTGC CATTTCAAAA TTGTTGCAAA CCTAAACACA ACATTTTAGA ATTTGTTGGG GGCACCACAT
CACTAAACAC TCTAAACAAT CACATGCTTG TCTGAAACCA GTTTAATGTG AAATAATTTA GAATTTGTGA AAAGAGTACC
CTTGCTTGGC CATCTTAGGT ATTTTATATT GCTAAAAGAA AGGAAATGAA GCCAAGGAAG TACTGCATTA GCTGGTGGGG
AAAGGATAAG AACTATGTCT ATTCACAACT GGAATTTTGT GAGTCTTAAT TCTGTAACGG TTGTACCAGT GATGATATAG
TTGTACAAAT ACAAAACTAT ATGTTTAGTC ACACATTTGG CAATTGCCTA ACAAATACAA CTCTACTATA ATATATAAGC
ATGTATAGAA ATTCCGCTAG GTCAATAGAG ATTAATGGAG GTTAGAAAGA TGCTACACAT TTCCAATCCT GCAATCTAAA
TGATGACATC AATGTAAGTG CCCAGATATT CCATTAAGAA AAAGAGAAGA GTATAAGGCG GAAAAACTAG TTTTTGACTT
ATCAAATATT GTTGGGAGTC AATAATCTGC AGAACCTAAC TTTACACAGT ATCTGAGGAA GGGTTGCTGG TAGGGCCAAA
ACAGAGGAAC AAATATCTAC TACTAGAAAA GGTATTGTGC CTGACCTATT CACAGCCCAA ATTTTGCAGT CAAACTAACT
TCATACATAA CAAAGGTCTA AAATCTTTAA CGGCTTCAGT GTAATCTCGG TCAGTCAACT GTGCCTGTGT AGGTCACTCT
GGATCATGAA AAGCATCACT GACAGAAATT ATCAAATCAT TTTCTGTTTT GATCTCTGGT AGTCTTCTGT TCCCCTTACC
AAAAATTTCA CTGTGCAGCC CACCAAAGAC AAGCAGAACA GCATGCTGAT CCTACAGGAG ACGTGTGCAG ACGCATCCGG
TTCAATGGTT GTGTATGCTC CTGTAGACAT CCCAGCAATG CACCTTGTCA TGAGTGGTGG GGATTCGTCA TGCGTCGCCC
TTCTTCCATC AGGTTTTGCC ATCCTGCCTG CTGGGCCTAG CATCGGCGCA GATCACAAGA TGGGCGGTTC ATTGCTCACC
GTTGCATTCC AGATACTTGC CAACAGCCAG CCCAGTGCTA AGCTCACGGT GGAGTCAGTC GAGACCGTGA GCAACCTTAT
CTCCTGCACC ATCAAGAAGA TCAAGACGGC GCTGCATTGC GACGTGTGAA CCCAACAAGG GGGGACTTTT GGCCTAGTGG
GAGCGGCTGT GGCGATGAGC CTGAGTCAAG AACGAACCGC GACATAGGAA GGGACCTTTG CTAGGTGGCA AGGACCGGAC
GGGGCAGGTC CTTAGCACAG AGCAATGGTG GTGGTTCGGG TATTGACTCA GCCTCTCCCG CCTCCGTTCT CTCCTGTGAC
TGGTGCATGT TGAAGTGAAC CTGCATTTTG GACGCCATGT AGCAGGCCAT CTTTCTTTCT TTTTCCTTTT TCTTTTTCTT
TTTCTTTTTT TAGGGAGAAG GGAGTCATCT GTGTTTTTTG TTGGCTGGCT CAGGGTGTTG GTGTTTCTGG TTTCTAGCTT
TTGTTACAGG GAGATGTGAT ACATTTTGTA GAAGCTCCGA ATTGTCGTGC TGGTATGTGA GGTTCTGATC ATAGGTCTGT
GTTTGATAGT CTCGAGCTAT CAACGCCTGG CAAATGCAAA CCTTGTTATG CTAAAATATG TTTTAGATCA ATCTGATTCT
GAAAGCTGTT TACATGTCCC 

Locus: Os04g0569100

Loading...

Locus: Os04g0569100

Loading...