Os04t0573000-01

Locus

Os04g0573000

Description

SPX-MFS protein, Phosphate transporter, Pi homeostasis

RAP-DB Gene Symbol Synonym(s)

OsSPX-MFS1

RAP-DB Gene Name Synonym(s)

SPX-MFS protein 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSPX-MFS1, SPX-MFS1

Oryzabase Gene Name Synonym(s)

SPX-MFS protein 1

Transcript Evidence

AK066068

Protein Evidence

Q0JAW2

Literature

PMID: 26424157

PMID: 22803610

PMID: 21062869

Note

Manual Curation

December 7, 2015

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: integral component of membrane (GO:0016021)

Functional domain (InterPro)

Major facilitator superfamily (IPR011701)

SPX domain (IPR004331)

Major facilitator superfamily domain (IPR020846)

Full-length cDNA

J013056J05 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0573000-01)

RiceXPro (AK066068)

Others

Oryzabase (11847)

KEGG (Os04t0573000-01)

Transcript

2705 bp

>Os04t0573000-01 SPX-MFS protein, Phosphate transporter, Pi homeostasis
ACCCCTCCCTCAGCTTCCCTTCCCATCTGCCCGTCTTCTTCTTCTTCCTCCTCCTCCTGC
CCTACCCGCGGCCGCGCGATATAAATACATCACCCTCCCCATCCGCCTCTCCGCCAGCAA
ACCAGCACAGCCGTACGCCGCCGGCAACTGCGTTCGCGCGAGCGCCTGTCCGCGTTGTAC
ATATTTGTGAGTAATCCGTCACCTCTGTACGCAGCACGCACATGCCGCCGCCAAAGCGCA
GATGATTCCAGTCTTTCCCTACTTTTGAATCTGTGCCTGATGAATCTGCGTCGTCGTGCT
GTAGCACTAGCGAGTGTTTCCCTTGCGACGTAGAGTTTGCTGATGTTCATCTAATTAGCC
CGGAGGACTCGGGAATCAGAATTCACCGTGGTGTCAGGGAGAAAAAGTGGATCGAACTTC
GGATCACCTGGTACCATTTGTTTACGATACAGGTATTGAACGACAAGATGGTTAATTTTG
GAAAGAAGTTGATGGCTGATCAAGTAGAAGAATGGAAAGGATACTATATTAACTACAAAT
TGATGAAGAAAATGTTGAAGCAATACGTTCAGCAGACCCAACTTGGTGGAAAAGATCGAG
AGCAAGTACTTAAAGAGTTCTCAAGAATTCTTGATGAACAGATTGAAAGGATTGTACTTT
TTCTGCTACAACAACAAGGCCACCTTGCTAATAGGATTGAGGAATTGGGAGAACAGCGTG
CTGCTCTTCTAGAACAGCATGATATATCCCAAGTTTTTCAACTACGAGAGGCTTATAGAG
AAGTTGGGCGAGATCTTATAAAGCTTCTCCGTTTTGTTGATATGAATGCTACTGGTATAA
GGAAGATTCTAAAGAAATTCGATAAGCGCTTTGGCTATAGGTTTACAGACTATTATGTCA
CCACTCGTGCAAACCATCCTTATTCTCAGCTTCAACAAGTCTTTAAGCAAGTGGGGATTG
TAGCTGTTGTAGGAGCTTTATCGCGCAACCTTGCATATCTGCAAGATCATGAAGGAAGTG
TTTTGTCCATCTATGATCATCCATCAGTTACCTTAAAGGACCCTATCATAGACCAAGTAA
ATCATGCGGTACAAAAACTTACACATGCGACGAGTTTTCTGCAATTCTTAGGTCAACATG
CACTTATCATCCAAGAGGACGTGCAAAGTGGGTCGGAGGATCTTGTCGATGATCAAAGTT
ACCATTTCATGTCTTTGATACTCAACCTAGTGAACACCTTTCTTTACATGGTGAACACAT
ATATCATTGTGCCAACTGCTGATGACTACGCTGTAAGCCTTGGAGCTGCAGCGACAGTTT
GTGGCGTAATCATCGGATCAATGGCAGTTGCTCAAGTGTTCTCCTCAGTTTATTTCAGTG
CATGGTCAAATAGGTCATACTTCAGACCTCTTGTATTCAGTAGCATCATGTTATTCGCTG
GGAATCTGCTATATGCATTAGCATATGACCTGAATTCTCTGACAGTTCTCCTGATTGGCC
GGCTACTATGCGGGTTAGGCTCTGCAAGAGCTGTGAACCGTCGATATATCAGCGATTGTG
TGCCTCTCAAAATCAGGCTACAGGCCTCTGCAGGATTCGTCAGTGCTAGTGCTCTTGGCA
TGGCATGTGGCCCTGCTCTTGCTGGTTTACTCCAGACAAGATTTAAGATATACTCACTCA
CTTTTGATCAGAGCACGTTGCCTGGGTGGGTCATGTGCATTGCTTGGCTTGTTTACTTGC
TGTGGCTGTGGATATCATTCAAAGAGCCGGGACACTTTGCTAAGAGTTCAGACACGGCAC
AGCCTGCTGAATCTGGCCATCAAGTCAATGCTAATCTGGAGGAAGGTCTAGCGCAACCAT
TGCTTACAGGCTCAGAAGAGGGACAAGACCAAAATGCTGAGGATAATGACGATAACGAAG
AGGAGTCTAAAAATTCTCACGGGCCAGCAACTTCAATCAGTTCAGCATACAAATTGTTGA
CACCATCTGTGAAGGTCCAGCTATTGATATACTTTATGCTCAAGTACGCTATGGAAATCT
TGCTCTCTGAATCAAGTGTCATCACCACATACTATTTTAACTGGTCTACAAGCGCTGTGG
CTATCTTTTTAGCGATTCTTGGGTGTACTGTTCTCCCTGTCAACGCCATTGTTGGAAGCT
ACATTACAAATTTATTCGAGGACAGGCAAATTTTGGTGGCATCTGAAATCATGGTCCTCA
TTGGTATAATCATGAGCTTCCGTTACACCCCTCACTACTCCGTTCCGCAGTACGTCTTGT
CCGCTCTCATCACATTTGTGTTTGCTGAGGTCCTCGAAGGAGTGAACCTGTCGTTGCTTT
CACGAGTAATGTCGTCGAGGCTCGCGCGAGGAACCTACAACGGCGGCCTCCTGTCGACAG
AGGCCGGGACGCTGGCCCGTGTAGTTGCAGACGCGACGATTACCGCGGCGGGTTATCTAG
GCCCGGACCTCCTGCTCAACATCACTCTGCTGCCACCTCTTGTCATCTGCATAGCCTCCC
TCGTTGCAACATTCTGCACATACAACACCCTGTACTAAGGAAGTTGCCTCTCTCTGCACA
CTGTAGAGCCGGTTAAACTTTATTCATGCTCACATTGGGTTGTATTTTACATGTATCTGC
ATGCGGTAGCATTCTTTGTTTGTACAAGTCCTTAAACAGTTCAATAAAATGTTCTTCTGT
AAATC

CDS

2091 bp

>Os04t0573000-01 SPX-MFS protein, Phosphate transporter, Pi homeostasis
ATGGTTAATTTTGGAAAGAAGTTGATGGCTGATCAAGTAGAAGAATGGAAAGGATACTAT
ATTAACTACAAATTGATGAAGAAAATGTTGAAGCAATACGTTCAGCAGACCCAACTTGGT
GGAAAAGATCGAGAGCAAGTACTTAAAGAGTTCTCAAGAATTCTTGATGAACAGATTGAA
AGGATTGTACTTTTTCTGCTACAACAACAAGGCCACCTTGCTAATAGGATTGAGGAATTG
GGAGAACAGCGTGCTGCTCTTCTAGAACAGCATGATATATCCCAAGTTTTTCAACTACGA
GAGGCTTATAGAGAAGTTGGGCGAGATCTTATAAAGCTTCTCCGTTTTGTTGATATGAAT
GCTACTGGTATAAGGAAGATTCTAAAGAAATTCGATAAGCGCTTTGGCTATAGGTTTACA
GACTATTATGTCACCACTCGTGCAAACCATCCTTATTCTCAGCTTCAACAAGTCTTTAAG
CAAGTGGGGATTGTAGCTGTTGTAGGAGCTTTATCGCGCAACCTTGCATATCTGCAAGAT
CATGAAGGAAGTGTTTTGTCCATCTATGATCATCCATCAGTTACCTTAAAGGACCCTATC
ATAGACCAAGTAAATCATGCGGTACAAAAACTTACACATGCGACGAGTTTTCTGCAATTC
TTAGGTCAACATGCACTTATCATCCAAGAGGACGTGCAAAGTGGGTCGGAGGATCTTGTC
GATGATCAAAGTTACCATTTCATGTCTTTGATACTCAACCTAGTGAACACCTTTCTTTAC
ATGGTGAACACATATATCATTGTGCCAACTGCTGATGACTACGCTGTAAGCCTTGGAGCT
GCAGCGACAGTTTGTGGCGTAATCATCGGATCAATGGCAGTTGCTCAAGTGTTCTCCTCA
GTTTATTTCAGTGCATGGTCAAATAGGTCATACTTCAGACCTCTTGTATTCAGTAGCATC
ATGTTATTCGCTGGGAATCTGCTATATGCATTAGCATATGACCTGAATTCTCTGACAGTT
CTCCTGATTGGCCGGCTACTATGCGGGTTAGGCTCTGCAAGAGCTGTGAACCGTCGATAT
ATCAGCGATTGTGTGCCTCTCAAAATCAGGCTACAGGCCTCTGCAGGATTCGTCAGTGCT
AGTGCTCTTGGCATGGCATGTGGCCCTGCTCTTGCTGGTTTACTCCAGACAAGATTTAAG
ATATACTCACTCACTTTTGATCAGAGCACGTTGCCTGGGTGGGTCATGTGCATTGCTTGG
CTTGTTTACTTGCTGTGGCTGTGGATATCATTCAAAGAGCCGGGACACTTTGCTAAGAGT
TCAGACACGGCACAGCCTGCTGAATCTGGCCATCAAGTCAATGCTAATCTGGAGGAAGGT
CTAGCGCAACCATTGCTTACAGGCTCAGAAGAGGGACAAGACCAAAATGCTGAGGATAAT
GACGATAACGAAGAGGAGTCTAAAAATTCTCACGGGCCAGCAACTTCAATCAGTTCAGCA
TACAAATTGTTGACACCATCTGTGAAGGTCCAGCTATTGATATACTTTATGCTCAAGTAC
GCTATGGAAATCTTGCTCTCTGAATCAAGTGTCATCACCACATACTATTTTAACTGGTCT
ACAAGCGCTGTGGCTATCTTTTTAGCGATTCTTGGGTGTACTGTTCTCCCTGTCAACGCC
ATTGTTGGAAGCTACATTACAAATTTATTCGAGGACAGGCAAATTTTGGTGGCATCTGAA
ATCATGGTCCTCATTGGTATAATCATGAGCTTCCGTTACACCCCTCACTACTCCGTTCCG
CAGTACGTCTTGTCCGCTCTCATCACATTTGTGTTTGCTGAGGTCCTCGAAGGAGTGAAC
CTGTCGTTGCTTTCACGAGTAATGTCGTCGAGGCTCGCGCGAGGAACCTACAACGGCGGC
CTCCTGTCGACAGAGGCCGGGACGCTGGCCCGTGTAGTTGCAGACGCGACGATTACCGCG
GCGGGTTATCTAGGCCCGGACCTCCTGCTCAACATCACTCTGCTGCCACCTCTTGTCATC
TGCATAGCCTCCCTCGTTGCAACATTCTGCACATACAACACCCTGTACTAA

Protein

697 aa

>Os04t0573000-01 SPX-MFS protein, Phosphate transporter, Pi homeostasis
MVNFGKKLMADQVEEWKGYYINYKLMKKMLKQYVQQTQLGGKDREQVLKEFSRILDEQIE
RIVLFLLQQQGHLANRIEELGEQRAALLEQHDISQVFQLREAYREVGRDLIKLLRFVDMN
ATGIRKILKKFDKRFGYRFTDYYVTTRANHPYSQLQQVFKQVGIVAVVGALSRNLAYLQD
HEGSVLSIYDHPSVTLKDPIIDQVNHAVQKLTHATSFLQFLGQHALIIQEDVQSGSEDLV
DDQSYHFMSLILNLVNTFLYMVNTYIIVPTADDYAVSLGAAATVCGVIIGSMAVAQVFSS
VYFSAWSNRSYFRPLVFSSIMLFAGNLLYALAYDLNSLTVLLIGRLLCGLGSARAVNRRY
ISDCVPLKIRLQASAGFVSASALGMACGPALAGLLQTRFKIYSLTFDQSTLPGWVMCIAW
LVYLLWLWISFKEPGHFAKSSDTAQPAESGHQVNANLEEGLAQPLLTGSEEGQDQNAEDN
DDNEEESKNSHGPATSISSAYKLLTPSVKVQLLIYFMLKYAMEILLSESSVITTYYFNWS
TSAVAIFLAILGCTVLPVNAIVGSYITNLFEDRQILVASEIMVLIGIIMSFRYTPHYSVP
QYVLSALITFVFAEVLEGVNLSLLSRVMSSRLARGTYNGGLLSTEAGTLARVVADATITA
AGYLGPDLLLNITLLPPLVICIASLVATFCTYNTLY*

5'UTR

chr04:28862600..28863045 (+ strand) : 446 bp

chr04:28864919..28864939 (+ strand) : 21 bp

CDS

chr04:28864940..28864992 (+ strand) : 53 bp

chr04:28865279..28865399 (+ strand) : 121 bp

chr04:28865560..28865871 (+ strand) : 312 bp

chr04:28865969..28866073 (+ strand) : 105 bp

chr04:28866175..28866629 (+ strand) : 455 bp

chr04:28866844..28867145 (+ strand) : 302 bp

chr04:28867317..28867495 (+ strand) : 179 bp

chr04:28867984..28868174 (+ strand) : 191 bp

chr04:28868323..28868456 (+ strand) : 134 bp

chr04:28868603..28868841 (+ strand) : 239 bp

3'UTR

chr04:28868842..28868988 (+ strand) : 147 bp

FASTA

>Os04t0573000-01 class=Sequence position=chr04:28862600..28868988 (+ strand)
ACCCCTCCCT CAGCTTCCCT TCCCATCTGC CCGTCTTCTT CTTCTTCCTC CTCCTCCTGC CCTACCCGCG GCCGCGCGAT
ATAAATACAT CACCCTCCCC ATCCGCCTCT CCGCCAGCAA ACCAGCACAG CCGTACGCCG CCGGCAACTG CGTTCGCGCG
AGCGCCTGTC CGCGTTGTAC ATATTTGTGA GTAATCCGTC ACCTCTGTAC GCAGCACGCA CATGCCGCCG CCAAAGCGCA
GATGATTCCA GTCTTTCCCT ACTTTTGAAT CTGTGCCTGA TGAATCTGCG TCGTCGTGCT GTAGCACTAG CGAGTGTTTC
CCTTGCGACG TAGAGTTTGC TGATGTTCAT CTAATTAGCC CGGAGGACTC GGGAATCAGA ATTCACCGTG GTGTCAGGGA
GAAAAAGTGG ATCGAACTTC GGATCACCTG GTACCATTTG TTTACGGTAT GTTCCTTGTT TCTTTCTGCG TGCCTTAGTT
CGAGGAGTAA AAGTCGCGGT TTGTTATATA GATTATTACC GGGAAGTGTT CGCTGAAATT TGGATTTGCA ATTATCTTCA
TTCTTCGGTT CGTGCGGTGT GATCTAAAAT GTTTTGCGGT TCTGCTTCTC TGTGTGGCTC CTGTTACATT GTTCTCCCTT
CGGCGGTTTG GCCGTCCCAT ACATGATACA ACATGGGAAT TGTGGGTAAT GTTACCGTGC GCAAATCTTC AAAGAAACTA
ATGCCAAACG AAGGCGAGGT CTGAGGGGTT CCAACTTCCA GTTTATAGCT GCATGTTGTC CTAAAGGTGC TTATTTTCAC
CAAGTGCTTA TTTTTTGTTA GTAATCAAGC ACGATAATGA CTTGTTTATT TTCTGGAAAT AAGAAGGGGC GAAGTTAATT
TGTTGGTCAG GATTTGGTGG ATATCTGTGG ATCCTTCTTT ATTTCAACAT TGACCATTTC CCATCACGCT AGCTGACTTT
ATTTTTTTTA AGAAGGGTAA ATAAAAAAAA TCACGCTAGC TGACTAGTTG TACTTTTCTC GTCCAAACAA ACTTGTAGAA
GGAAGAGAAT ATTTTTTACC TTTTCACCTC AAATTAAACA GCCATACAAC TTGCAAGATA TAtactccct caggtcataa
atatgtgatg tttaggataa tatttggtct attacttact tccgaaatgc atatagttta ataacaagaa aaattatatg
catagagtgg cctagaaaag ttacaatagc atgaacttat tggattttat agacttactc taatataaaa ttgatggtca
aaattttaat ggtctgatca aatcttgttt taaacgtaaa atatttttta ttggaggaag taGTTTTTAG GAATCTGTAA
GATAATGAAC AAGGGAAAGA ACTTTCAAGA CAATTAGTTC TTTTTCTGGC AAAGTGAAAG AGAAGTTGTT GAAGTACTCT
AGCCATATGA TTGATTACGT GTCCTAAGTA ACAAGGAGCT CCTCTAACAA AAGGGGACCA TATGCTGCCA CGTCACTGTC
AGTTTTGTGT TATGTACCTG GCTTATCAAC TTAGAGCCAA TCGCTAACAC TTTATGAACA ATCATTCAGT ACTGATGTTG
ATCTGCATAT TTTAACTACT GTGATTTTTT TTAATCTCCG ATTGATCTGT CTCTACTTGT GACTGTAAAG TTCTGTCCAG
CTGTCTTTTG TTAATAATAA CTTGCTTTTT GCTATGCTCT CTTACGACGA ATATTCAGCA CGTTTTATGT TTGCTCGACT
TCTATAGTTA GACACTTTTT AAATATCACG CGTTCAGACT AAATAGTGAT ACCCTTCTCT GTTTTTCTTC TTGAGAGGAT
ATTCAAAAAC TTCCAGTGGC TGCCTTAATC ATTTCTCTAC AGTGTACTTT ATCAGTAAAA TCCTTACGGC ACATGTACTG
TCTTCATTTC ATCTTCTGTT CTCATTGATA TTAACTGTTA GAGGTTACTC GTTGAGGATC AATCAACTCT GTCCATCTGC
CGTACGTGAT GAACGACGGA AAAAAAAACA AAGGCAAGGA TGGGTTGGAT ACGAAACATT GGATTGCTGT TTTGTTTGAT
CACAAATGCT AAACAGTGTC CGCGTGCTGA AAATTGACTA AAGTTAACTT GCTTCGCTAC CTTTCCTTTA GAATAGTTAT
CCATTTGGTA GTAGCAAATA TCTGAATAAG TTAATTACTC AAAAAGTAAA CATAAAGATA GCTGTAGACA TGTTTTTTTT
GCTGAAATAA TAGCTTGGTG CAAATGTGTG CTTTTGTTGA TCTTTCTACA TCTAATCATT TATATATGTT CGGTTTTAGA
TACAGGTATT GAACGACAAG ATGGTTAATT TTGGAAAGAA GTTGATGGCT GATCAAGTAG AAGAATGGAA AGGGTATGCT
TTTGGTACTT ATTTTTTATG AACAAAATAA TTTTCTTCAT TGATTACACA CTACTATGTA AAAAAAATTA TATGCCTTCC
TATTATGATA CCTAAAAATG AAACAGAAGT TGAGTACCCA TCAAACTATT ACGTCAATCT ATAATGATTT TTTTAATGAA
CTATGATGAA ATTTGAAGGT TATGATGTGG ACTCCATAAG CAATTTTCAC AAGCCAGTTC CTCCATATTA ACAAATTTCC
TGCAGAAATC TTATGATTTC CTCATCTTGA TATTACTAGA TACTATATTA ACTACAAATT GATGAAGAAA ATGTTGAAGC
AATACGTTCA GCAGACCCAA CTTGGTGGAA AAGATCGAGA GCAAGTACTT AAAGAGTTCT CAAGAATTCT TGATGAACAG
GTATATATGC AAACATTTCT TTTTTTAATT AATTATAAAG ATATATTATT GGATCAACTT GTTTATTTCA TCTATTGTTG
GTTTAATAAA GAACTCGTGT TTCTTAAAAT GGTATCATTG TTTTGATTAG CTAAAATTCA TACTTGCTGT TTCACTTCAG
ATTGAAAGGA TTGTACTTTT TCTGCTACAA CAACAAGGCC ACCTTGCTAA TAGGATTGAG GAATTGGGAG AACAGCGTGC
TGCTCTTCTA GAACAGCATG ATATATCCCA AGTTTTTCAA CTACGAGAGG CTTATAGAGA AGTTGGGCGA GATCTTATAA
AGCTTCTCCG TTTTGTTGAT ATGAATGCTA CTGGTATAAG GAAGATTCTA AAGAAATTCG ATAAGCGCTT TGGCTATAGG
TTTACAGACT ATTATGTCAC CACTCGTGCA AACCATCCTT ATTCTCAGCT TCAACAAGTC TTTAAGCAAG TGGTAATTTT
TCTGGCATTT TACATGATTA GGGACACTTG ATTTTCTTCT GTCTCTCACA GCTAACCAGC ATTCCTTTTG TCCACTTCTA
CCAATGCAGG GGATTGTAGC TGTTGTAGGA GCTTTATCGC GCAACCTTGC ATATCTGCAA GATCATGAAG GAAGTGTTTT
GTCCATCTAT GATCATCCAT CAGTTACCTT AAAGGTTTTA TGTCTTGACT GTTACATTAT CTGAATTTGG AACTAGTTTT
CTACATATCT TTTGCATGAT GTAAGAGTGT AATGTGACTA TTTTCTGATA TTCAGGACCC TATCATAGAC CAAGTAAATC
ATGCGGTACA AAAACTTACA CATGCGACGA GTTTTCTGCA ATTCTTAGGT CAACATGCAC TTATCATCCA AGAGGACGTG
CAAAGTGGGT CGGAGGATCT TGTCGATGAT CAAAGTTACC ATTTCATGTC TTTGATACTC AACCTAGTGA ACACCTTTCT
TTACATGGTG AACACATATA TCATTGTGCC AACTGCTGAT GACTACGCTG TAAGCCTTGG AGCTGCAGCG ACAGTTTGTG
GCGTAATCAT CGGATCAATG GCAGTTGCTC AAGTGTTCTC CTCAGTTTAT TTCAGTGCAT GGTCAAATAG GTCATACTTC
AGACCTCTTG TATTCAGTAG CATCATGTTA TTCGCTGGGA ATCTGCTATA TGCATTAGCA TATGACCTGA ATTCTCTGAC
AGTTCTCCTG ATTGGCCGGC TACTATGCGG GTACGTAGAA TTTATTTTTC TATTTGTTTT AAACCCTATT ACTCAGTACC
TCTTGCTAAT GAATTGTAAT CATGTTGAGG TAGGACTACA ATTTAGTATG GTAAATATTG CTGGCTCTTA ATATTTACCA
CCAACCCTGT TTGTCTTCTT CTCGATTATT CATCAGTATT TCTGGATTGA AATTTACTGA TCATAATACA ATACTCATAT
GCAGGTTAGG CTCTGCAAGA GCTGTGAACC GTCGATATAT CAGCGATTGT GTGCCTCTCA AAATCAGGCT ACAGGCCTCT
GCAGGATTCG TCAGTGCTAG TGCTCTTGGC ATGGCATGTG GCCCTGCTCT TGCTGGTTTA CTCCAGACAA GATTTAAGAT
ATACTCACTC ACTTTTGATC AGAGCACGTT GCCTGGGTGG GTCATGTGCA TTGCTTGGCT TGTTTACTTG CTGTGGCTGT
GGATATCATT CAAAGAGCCG GGACACTTTG CTAAGAGTTC AGACACGGCA CAGCCTGCTG AATCTGGTAA GTTCTCAACC
CACAGGAAGA GTGACTAGCA AATATATTCC TTCCGAAAAC TAAACACAAC ATGATTCTGT TGATTTGGAA GTGCAAATGT
TGCCTGTAAA GAATTTTTTT TTATCAGCAT CAGGATTTTT GTTTTCTAAT ATAGAGTTAT TTTTTGATTA AAAATAGGCC
ATCAAGTCAA TGCTAATCTG GAGGAAGGTC TAGCGCAACC ATTGCTTACA GGCTCAGAAG AGGGACAAGA CCAAAATGCT
GAGGATAATG ACGATAACGA AGAGGAGTCT AAAAATTCTC ACGGGCCAGC AACTTCAATC AGTTCAGCAT ACAAATTGTT
GACACCATCT GTGAAGGTTT CCTCCTTTCC CCTCGTCAAC TTCTTTTCTT TTATTCCAGA TCAACGTTGC AGCATACACG
AAAAACAAGT TCACAAACTA ATCAAGTTGG GTTCTTATAA CTATAAATGA ACTGCAGAAC ATAAAATGAA GAGAAGTATC
TCGGTGTTAG CATCTTACTG TCCACAACAA TAATAGCTAT GCTGCGGTTG TATTTACACT TCCAAAAATA CAATTTCAAG
AAAAAAAAAG TTCTTCATTA GCATTACTTC GATTGCTTTT TTTCAAGCTA TTGGTTAGCT TTATAATATA TTTAATTAAG
CCCTATAAGC AATAAATCGT CTGTCATTTC ATCTCTTTCA AACTAGGCCT AATACTGACA CATGAGTGCT CCGCACTGTC
AAGATTACTC TCAACTCTCA TGTTAAGTTT ATTTTTTATC CGTTGGATGC ATCATCTTTC TATGTTTTGT TTTGCAATAC
ATTACATGGA CGCTCATTTC TCAGGTCCAG CTATTGATAT ACTTTATGCT CAAGTACGCT ATGGAAATCT TGCTCTCTGA
ATCAAGTGTC ATCACCACAT ACTATTTTAA CTGGTCTACA AGCGCTGTGG CTATCTTTTT AGCGATTCTT GGGTGTACTG
TTCTCCCTGT CAACGCCATT GTTGGAAGCT ACATTACAAA TTTATTCGAG GACAGGTAAT TTTTATGCTC GTTAAGTGCA
CTTTGTATCC CTCGCCCAAA AAAAGGATTT TGAAGGTCTA AATAAAGTCC ATTCAAAATG ATTTCATGAA AGCATGTAAT
TAAGGGTATT GTTAACGGCT GCTTTGTACA TGGTATTTTG CAGGCAAATT TTGGTGGCAT CTGAAATCAT GGTCCTCATT
GGTATAATCA TGAGCTTCCG TTACACCCCT CACTACTCCG TTCCGCAGTA CGTCTTGTCC GCTCTCATCA CATTTGTGTT
TGCTGAGGTC CTCGAAGGTA TGTAAACGCA ACCACCTCAA AATGATCGTT CATCACACAG CCCTTCAGCA GCATGACATC
TGACGGCACA AAGCGAGATC TGAATCAAGC AAACGCATGC TGTTGCTTTA ACCACTGTTT TCCATTTCTG ACGAACATTG
CAGGAGTGAA CCTGTCGTTG CTTTCACGAG TAATGTCGTC GAGGCTCGCG CGAGGAACCT ACAACGGCGG CCTCCTGTCG
ACAGAGGCCG GGACGCTGGC CCGTGTAGTT GCAGACGCGA CGATTACCGC GGCGGGTTAT CTAGGCCCGG ACCTCCTGCT
CAACATCACT CTGCTGCCAC CTCTTGTCAT CTGCATAGCC TCCCTCGTTG CAACATTCTG CACATACAAC ACCCTGTACT
AAGGAAGTTG CCTCTCTCTG CACACTGTAG AGCCGGTTAA ACTTTATTCA TGCTCACATT GGGTTGTATT TTACATGTAT
CTGCATGCGG TAGCATTCTT TGTTTGTACA AGTCCTTAAA CAGTTCAATA AAATGTTCTT CTGTAAATC

Locus: Os04g0573000

Loading...

Locus: Os04g0573000

Loading...