Os04t0578000-01

Locus

Os04g0578000

Description

ACC synthase, Ethylene biosynthesis

RAP-DB Gene Symbol Synonym(s)

ACS2, OsACS2, Os-ACS2

RAP-DB Gene Name Synonym(s)

ACC SYNTHASE 2, ACC synthase 2, 1-aminocyclopropane-1-carboxylic acid synthase 2

CGSNL Gene Symbol

ACS2

CGSNL Gene Name

ACC SYNTHASE 2

Oryzabase Gene Symbol Synonym(s)

OsACS2, Os-ACS2

Oryzabase Gene Name Synonym(s)

ACC synthase 2, 1-aminocyclopropane-1-carboxylic acid synthase 2

Transcript Evidence

AK064250

Protein Evidence

Q7XQ85

Literature

PMID: 17012402

Note

Manual Curation

November 24, 2009

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: pyridoxal phosphate binding (GO:0030170)

Functional domain (InterPro)

Pyridoxal phosphate-dependent transferase (IPR015424)

Aminotransferase, class I/classII (IPR004839)

Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (IPR015422)

Aminotransferases, class-I, pyridoxal-phosphate-binding site (IPR004838)

Full-length cDNA

002-105-C04 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0578000-01)

RiceXPro (AK064250)

Others

Oryzabase (6850)

KEGG (Os04t0578000-01 (EC:4.4.1.14))

Transcript

2112 bp

>Os04t0578000-01 ACC synthase, Ethylene biosynthesis
AAACAAGCCAGCTCAATCAATCATCGAGCTAGCTGAGCTAGCTAAGTGCCATATTGCACG
TACTCGTTGTCTGTCCGATCATCCTTTTTTTTTTCTTGTGGGGGTCTGTCCGATCATCCT
TGCGTGGCTAGGCAGGTAGAGTAGCTACCTGCTCGGCTGCTCGCGTTCCAGCCAGGGTCC
GGGCTTCGGATATCCTCGGAGTCCGACACCAAATCAATGGCGTACCAGGGCATCGACCTT
CTCTCGACGAAAGCCGCAGGCGATGACCACGGCGAGAATTCATCGTACTTCGACGGGTGG
AAGGCCTACGACACGAACCCGTTCGACCTGCGGCACAATCGCGGGGGTGTCATCCAGATG
GGTCTCGCCGAGAACCAGCTTTCTCTGGACCTGATCGAGGAATGGAGCAAGAACCACCCC
GAGGCATCCATTTGCACACCGGAGGGCGTCTCGCAGTTCAAGAGGATCGCCAATTTCCAG
GATTACCACGGCCTCCCGGAGTTCAGAAAGGCGATGGCCCAGTTTATGGGGCAGGTGAGG
GGAGGCAAGGCAACGTTTGACCCCGACCGTGTCGTCATGAGCGGCGGCGCCACCGGCGCC
CAGGAGACGCTCGCCTTCTGCCTCGCCAACCCCGGCGAGGCCTTCCTCGTGCCCACGCCA
TACTACCCAGCTTTCGACCGCGACTGTTGCTGGAGGTCAGGAATAAAGCTGCTGCCGATC
GAGTGCCACAGCTTCAACGACTTCAGGCTCACCAAGGAGGCCCTCGTGTCGGCGTACGAC
GGCGCACGGAGGCAGGGCATCTCCGTCAAGGGGATCCTCATCACCAACCCGTCCAACCCG
CTCGGCACCATCACCGACCGCGACACGCTGGCCATGCTCGCCACCTTCGCCACCGAGCAC
CGCGTCCACCTCGTCTGCGACGAGATCTACGCGGGGTCGGTGTTCGCCACGCCGGAGTAC
GTGAGCATCGCCGAGGTCATCGAGCGCGACGTGCCGTGGTGCAACAGGGACCTGATCCAC
GTCGTGTACAGCCTCTCCAAGGACTTCGGCCTCCCCGGCTTCCGCGTCGGCATCATCTAC
TCGTACAACGACGCCGTCGTGGCGGCCGCGCGCAGGATGTCCAGCTTCGGGCTCGTCTCG
TCGCAGACGCAGTACTTCCTCGCCAGGATGCTCTCGGACGAGGAGTTCATCGGCCGCTTC
CTCCAGGAGAGCAAGTGTCGGCTGGTGGCGCGGCACGAGCGGTTCACCTCTGGCCTCCGC
GAGGTCGGGATCGGCTGCCTGCGCGGCAACGCCGGGCTGTTCTCGTGGATGGACCTGCGC
CGCATGCTCCGGGAGAAGACGGCCGAGGCGGAGCTGGAGCTGTGGCGGGTGATCGTACAC
CAGGTGAAGCTGAACGTGTCGCCCGGCACGTCGTTCCACTGCCGCGAGCCCGGGTGGTTC
CGCGTCTGCCACGCCAACATGGACGACGAGACCATGGAGGTCGCGCTCGGCCGGATCCAC
GACTTCGTGCGCCAGCACCAGCAGCGCAGGGTCAAGGCCGAGCGCTGGGCCGCCAATAGG
CAGCTCCGCCTCAGCCTGCCGCACCACCACCACCTCAGCCCAGCCCATCTCTCCAGTCCA
TTGGCGCTCCTGTCGCCGCAGTCCCCGATGGTTCGCGCCACCAGCTGATTAAGCCAGCAG
TGCACTTGCTCTGCTAATGCTGCGCCTTACTACGTCGACTACATTTTCATAACCATTTTT
TTCTCGATCGCATCGTCGCACGGCGGCACGGGGCCGTATGGTGTTCTTTCCGATGCAGGT
ACGTGTGATCGTTTGTGGAAACTAGGCTACACGTGCACGGCACCGTACATGTAGCTTGGC
TTTTTTGTAGAGACGTGCGTTAGTGCGTACAGGCGTCGCCGCGTCGGGTGTACATAGGTA
ATTTTAGTAGCGTGTGTAACAGGGGTATCGGAGATTCGGAGTCCTCGATTCTTTTGTGTA
TGGTTTGGTTAATTCAGATGGCAAGGAATAATGATCGGATTAAGGCGTTAAGCCCCCCGA
TCGGCTCTTGTAAACTGTAAAGTGTAAACACGTTACACTTACAATAAGGCTTAGGATTGA
ATCGATCCGGAT

CDS

1452 bp

>Os04t0578000-01 ACC synthase, Ethylene biosynthesis
ATGGCGTACCAGGGCATCGACCTTCTCTCGACGAAAGCCGCAGGCGATGACCACGGCGAG
AATTCATCGTACTTCGACGGGTGGAAGGCCTACGACACGAACCCGTTCGACCTGCGGCAC
AATCGCGGGGGTGTCATCCAGATGGGTCTCGCCGAGAACCAGCTTTCTCTGGACCTGATC
GAGGAATGGAGCAAGAACCACCCCGAGGCATCCATTTGCACACCGGAGGGCGTCTCGCAG
TTCAAGAGGATCGCCAATTTCCAGGATTACCACGGCCTCCCGGAGTTCAGAAAGGCGATG
GCCCAGTTTATGGGGCAGGTGAGGGGAGGCAAGGCAACGTTTGACCCCGACCGTGTCGTC
ATGAGCGGCGGCGCCACCGGCGCCCAGGAGACGCTCGCCTTCTGCCTCGCCAACCCCGGC
GAGGCCTTCCTCGTGCCCACGCCATACTACCCAGCTTTCGACCGCGACTGTTGCTGGAGG
TCAGGAATAAAGCTGCTGCCGATCGAGTGCCACAGCTTCAACGACTTCAGGCTCACCAAG
GAGGCCCTCGTGTCGGCGTACGACGGCGCACGGAGGCAGGGCATCTCCGTCAAGGGGATC
CTCATCACCAACCCGTCCAACCCGCTCGGCACCATCACCGACCGCGACACGCTGGCCATG
CTCGCCACCTTCGCCACCGAGCACCGCGTCCACCTCGTCTGCGACGAGATCTACGCGGGG
TCGGTGTTCGCCACGCCGGAGTACGTGAGCATCGCCGAGGTCATCGAGCGCGACGTGCCG
TGGTGCAACAGGGACCTGATCCACGTCGTGTACAGCCTCTCCAAGGACTTCGGCCTCCCC
GGCTTCCGCGTCGGCATCATCTACTCGTACAACGACGCCGTCGTGGCGGCCGCGCGCAGG
ATGTCCAGCTTCGGGCTCGTCTCGTCGCAGACGCAGTACTTCCTCGCCAGGATGCTCTCG
GACGAGGAGTTCATCGGCCGCTTCCTCCAGGAGAGCAAGTGTCGGCTGGTGGCGCGGCAC
GAGCGGTTCACCTCTGGCCTCCGCGAGGTCGGGATCGGCTGCCTGCGCGGCAACGCCGGG
CTGTTCTCGTGGATGGACCTGCGCCGCATGCTCCGGGAGAAGACGGCCGAGGCGGAGCTG
GAGCTGTGGCGGGTGATCGTACACCAGGTGAAGCTGAACGTGTCGCCCGGCACGTCGTTC
CACTGCCGCGAGCCCGGGTGGTTCCGCGTCTGCCACGCCAACATGGACGACGAGACCATG
GAGGTCGCGCTCGGCCGGATCCACGACTTCGTGCGCCAGCACCAGCAGCGCAGGGTCAAG
GCCGAGCGCTGGGCCGCCAATAGGCAGCTCCGCCTCAGCCTGCCGCACCACCACCACCTC
AGCCCAGCCCATCTCTCCAGTCCATTGGCGCTCCTGTCGCCGCAGTCCCCGATGGTTCGC
GCCACCAGCTGA

Protein

484 aa

>Os04t0578000-01 ACC synthase, Ethylene biosynthesis
MAYQGIDLLSTKAAGDDHGENSSYFDGWKAYDTNPFDLRHNRGGVIQMGLAENQLSLDLI
EEWSKNHPEASICTPEGVSQFKRIANFQDYHGLPEFRKAMAQFMGQVRGGKATFDPDRVV
MSGGATGAQETLAFCLANPGEAFLVPTPYYPAFDRDCCWRSGIKLLPIECHSFNDFRLTK
EALVSAYDGARRQGISVKGILITNPSNPLGTITDRDTLAMLATFATEHRVHLVCDEIYAG
SVFATPEYVSIAEVIERDVPWCNRDLIHVVYSLSKDFGLPGFRVGIIYSYNDAVVAAARR
MSSFGLVSSQTQYFLARMLSDEEFIGRFLQESKCRLVARHERFTSGLREVGIGCLRGNAG
LFSWMDLRRMLREKTAEAELELWRVIVHQVKLNVSPGTSFHCREPGWFRVCHANMDDETM
EVALGRIHDFVRQHQQRRVKAERWAANRQLRLSLPHHHHLSPAHLSSPLALLSPQSPMVR
ATS*

5'UTR

chr04:29134467..29134682 (- strand) : 216 bp

CDS

chr04:29134305..29134466 (- strand) : 162 bp

chr04:29134080..29134211 (- strand) : 132 bp

chr04:29133730..29133890 (- strand) : 161 bp

chr04:29132327..29133323 (- strand) : 997 bp

3'UTR

chr04:29131883..29132326 (- strand) : 444 bp

FASTA

>Os04t0578000-01 class=Sequence position=chr04:29131883..29134682 (- strand)
AAACAAGCCA GCTCAATCAA TCATCGAGCT AGCTGAGCTA GCTAAGTGCC ATATTGCACG TACTCGTTGT CTGTCCGATC
ATCCTTTTTT TTTTCTTGTG GGGGTCTGTC CGATCATCCT TGCGTGGCTA GGCAGGTAGA GTAGCTACCT GCTCGGCTGC
TCGCGTTCCA GCCAGGGTCC GGGCTTCGGA TATCCTCGGA GTCCGACACC AAATCAATGG CGTACCAGGG CATCGACCTT
CTCTCGACGA AAGCCGCAGG CGATGACCAC GGCGAGAATT CATCGTACTT CGACGGGTGG AAGGCCTACG ACACGAACCC
GTTCGACCTG CGGCACAATC GCGGGGGTGT CATCCAGATG GGTCTCGCCG AGAACCAGGT ACGCGCACAG ACCTGTGTAT
ACTCATTTCT GAATTAAGGA TCGTTCTCGA CAAAGTGCTA ATCCGTCTTT GTTGCCCTGT AAATGTCACA GCTTTCTCTG
GACCTGATCG AGGAATGGAG CAAGAACCAC CCCGAGGCAT CCATTTGCAC ACCGGAGGGC GTCTCGCAGT TCAAGAGGAT
CGCCAATTTC CAGGATTACC ACGGCCTCCC GGAGTTCAGA AAGGTAAGGC CAATCAATCG CTGACATCAC ATCAGCATAT
TAGACAAGCT ATATAACATC ATAGAAAATT CGATAAAAAT ATTGAGAACC AGATAGATGA CAAAGCTGCT GCTTGCGACC
GTGAAAGCAA CGCAGCAACT AGCGTTCGGG AGGTCATATT GTTAACAACT GAATGTGATT GTGATGTTGC AGGCGATGGC
CCAGTTTATG GGGCAGGTGA GGGGAGGCAA GGCAACGTTT GACCCCGACC GTGTCGTCAT GAGCGGCGGC GCCACCGGCG
CCCAGGAGAC GCTCGCCTTC TGCCTCGCCA ACCCCGGCGA GGCCTTCCTC GTGCCCACGC CATACTACCC AGCGTATGTC
CCGTCAACCT TAACTATCAC AACTGAAACT GAATTTGTTC TCTTCCGCTC GTAGAAGTCT TCTGTTTCCT CTGAATATCT
AGTAGTTCGT CAAACGAGGA AAAGATATCC GAGTGTCAAC TAAGAAAATC AGATAACATT CTCTCCGAGA TTTGAGTTAC
GTTTTAAAAT TGGCTTGGAG AGAAAAGATG GATTAATTTT CCCGTGATTG AATCAAACTG CGACCTAATT ATGGATGCCG
TTGAAGTCAA ATGACTAAAT CTAGTCATGC AAGCAAACGC ATGCACGATG TTCGCACACG GTCGTAGTCA ATGCAATTTT
AACTCTGATG CATGTTTACA ATGTAACATA GCTGAGGTAG CTAAGCCTAA GGCCTGACGA CATGTGCTTC CGTTGACAGT
TTCGACCGCG ACTGTTGCTG GAGGTCAGGA ATAAAGCTGC TGCCGATCGA GTGCCACAGC TTCAACGACT TCAGGCTCAC
CAAGGAGGCC CTCGTGTCGG CGTACGACGG CGCACGGAGG CAGGGCATCT CCGTCAAGGG GATCCTCATC ACCAACCCGT
CCAACCCGCT CGGCACCATC ACCGACCGCG ACACGCTGGC CATGCTCGCC ACCTTCGCCA CCGAGCACCG CGTCCACCTC
GTCTGCGACG AGATCTACGC GGGGTCGGTG TTCGCCACGC CGGAGTACGT GAGCATCGCC GAGGTCATCG AGCGCGACGT
GCCGTGGTGC AACAGGGACC TGATCCACGT CGTGTACAGC CTCTCCAAGG ACTTCGGCCT CCCCGGCTTC CGCGTCGGCA
TCATCTACTC GTACAACGAC GCCGTCGTGG CGGCCGCGCG CAGGATGTCC AGCTTCGGGC TCGTCTCGTC GCAGACGCAG
TACTTCCTCG CCAGGATGCT CTCGGACGAG GAGTTCATCG GCCGCTTCCT CCAGGAGAGC AAGTGTCGGC TGGTGGCGCG
GCACGAGCGG TTCACCTCTG GCCTCCGCGA GGTCGGGATC GGCTGCCTGC GCGGCAACGC CGGGCTGTTC TCGTGGATGG
ACCTGCGCCG CATGCTCCGG GAGAAGACGG CCGAGGCGGA GCTGGAGCTG TGGCGGGTGA TCGTACACCA GGTGAAGCTG
AACGTGTCGC CCGGCACGTC GTTCCACTGC CGCGAGCCCG GGTGGTTCCG CGTCTGCCAC GCCAACATGG ACGACGAGAC
CATGGAGGTC GCGCTCGGCC GGATCCACGA CTTCGTGCGC CAGCACCAGC AGCGCAGGGT CAAGGCCGAG CGCTGGGCCG
CCAATAGGCA GCTCCGCCTC AGCCTGCCGC ACCACCACCA CCTCAGCCCA GCCCATCTCT CCAGTCCATT GGCGCTCCTG
TCGCCGCAGT CCCCGATGGT TCGCGCCACC AGCTGATTAA GCCAGCAGTG CACTTGCTCT GCTAATGCTG CGCCTTACTA
CGTCGACTAC ATTTTCATAA CCATTTTTTT CTCGATCGCA TCGTCGCACG GCGGCACGGG GCCGTATGGT GTTCTTTCCG
ATGCAGGTAC GTGTGATCGT TTGTGGAAAC TAGGCTACAC GTGCACGGCA CCGTACATGT AGCTTGGCTT TTTTGTAGAG
ACGTGCGTTA GTGCGTACAG GCGTCGCCGC GTCGGGTGTA CATAGGTAAT TTTAGTAGCG TGTGTAACAG GGGTATCGGA
GATTCGGAGT CCTCGATTCT TTTGTGTATG GTTTGGTTAA TTCAGATGGC AAGGAATAAT GATCGGATTA AGGCGTTAAG
CCCCCCGATC GGCTCTTGTA AACTGTAAAG TGTAAACACG TTACACTTAC AATAAGGCTT AGGATTGAAT CGATCCGGAT

Locus: Os04g0578000

Loading...

Locus: Os04g0578000

Loading...