Os04t0581400-01

Locus

Os04g0581400

Description

B3 DNA binding domain containing protein, Brassinosteroid homeostasis

RAP-DB Gene Symbol Synonym(s)

RAVL1

RAP-DB Gene Name Synonym(s)

RAV-Like1, RAV-like 1 protein, RAV-LIKE 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

RAVL1, RAVL

Oryzabase Gene Name Synonym(s)

RAV-Like1, RAV-like 1 protein, RAV-LIKE 1

Transcript Evidence

HM450152 (Genbank)

(This (guanine) was observed in Nipponbare (between 29367253 and 29367254), which resulted in the frameshift.)

Protein Evidence

D9MNL6 (UniProt)

Literature

PMID: 20581303

Note

Manual Curation

January 7, 2011

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

B3 DNA binding domain (IPR003340)

DNA-binding pseudobarrel domain (IPR015300)

Expression Databases

TENOR (Os04t0581400-00)

Others

Oryzabase (14293)

Transcript

1453 bp

>Os04t0581400-01 B3 DNA binding domain containing protein, Brassinosteroid homeostasis
ATGGAGCAGGAGCAGGATGAAGAGGAGGAGGAGGCGGAGGCCTCGCCCCGCGAGATCCCC
TTCATGACGTCGGCGGCGGCGGCGGCCACCGCCTCATCGTCCTCCCCGACATCGGTCTCC
CCTTCCGCCACCGCTTCcgcggcggcgtccacgtcggcgtcgggctctcccttccggtcg
agcgacggtgcgggagcgtcggggagtggcggcggcggtggcggcgaggacgtggaggtg
atcgagaaggagcacatgttcgacaaggtggtgacgccgagcgacgtggggaagctgaac
cggctggtgatcccgaagcagcacgccgagaagtacttcccgctggactcggcggcgaac
gagaagggcCTTCTCCTCAGCTTCGAGGACCGAACCGGCAAGCTATGGCGCTTCCGCTAC
TCCTACTGGAACAGCAGCCAGAGCTACGTCATGACCAAGGGTTGGAGCCGCTTCGTCAAG
GAGAAGCGCCTCGACGCCGGGGACACCGTCTCCTTCTGCCGCGGCGCCGCCGAGGCCACC
CGCGACCGCCTCTTCATCGACTGGAAGCGCCGCGCCGACGTCCGCGACCCGCACCGCTTC
CAGCGCCTACCGCTCCCCATGACCTCGCCCTACGGCCCGTGGGGCGGCGGCGCGGGCGCT
TCTTCATgccgcccgcgccgcccgccacgctctacgagcatcaccgctttcgccagggct
tcgacttccgcaacatcaaccccgctgtgccggcgaggcagctcgtcttcttcggctccc
cagggacggggattcatcagcacccgcccttgccaccgccgccgtcgccacctccgcctc
ctcaccAACTCCACATTACGGTGCACCACCCGAGCCCCGTAGTCACCGCCGGCCTGCCCA
TGGTTGTCGACTCGGTGCCGCACGTCAACAACCCAGCGGCGGCATCGAAGCGCGTCCGGC
TGTTCGGAGTCAACCTCGATAACCCACATCCGGACGGCGGCCAGTCGTCGAGCGGCCACG
ACGCCAATGCATTGTCGCTACGGATGCCCGGGTGGCAAAGGCCTGCACCATTGAGGTCGC
TGGAATTGCCTCCACACATGCCGGCTGGTGCAGCTGGAGCGGAGTCCTCTGCCGCGTCGT
CGCCGTCGTCATCGTCGTCATCCAAGAGAGAGGCGCACTCCTCGTTGGATCTCGATCTGT
GAAGGAGGGATCAGGCCACCTCGATCGATCGGGAGCGTACCAAAGGAAAGTTCAAAAAAT
CCATCTTCCGTCTGCTGCCTTCTTCTACTTCTCCACCTTTTGCAATTCTCCATCATAACT
TTGATCATAGAGTTAGCATAACTTTTGGTTTCCTTTTTTGTTTTTGGCCATTCACATTCT
TATGTTTGTTTGAGAATATATAGAGAAAAATTAGGCGAATTAATGAATTATTAATGTTTT
TATTTGGGTTTAG

CDS

882 bp

>Os04t0581400-01 B3 DNA binding domain containing protein, Brassinosteroid homeostasis
ATGGAGCAGGAGCAGGATGAAGAGGAGGAGGAGGCGGAGGCCTCGCCCCGCGAGATCCCC
TTCATGACGTCGGCGGCGGCGGCGGCCACCGCCTCATCGTCCTCCCCGACATCGGTCTCC
CCTTCCGCCACCGCTTCcgcggcggcgtccacgtcggcgtcgggctctcccttccggtcg
agcgacggtgcgggagcgtcggggagtggcggcggcggtggcggcgaggacgtggaggtg
atcgagaaggagcacatgttcgacaaggtggtgacgccgagcgacgtggggaagctgaac
cggctggtgatcccgaagcagcacgccgagaagtacttcccgctggactcggcggcgaac
gagaagggcCTTCTCCTCAGCTTCGAGGACCGAACCGGCAAGCTATGGCGCTTCCGCTAC
TCCTACTGGAACAGCAGCCAGAGCTACGTCATGACCAAGGGTTGGAGCCGCTTCGTCAAG
GAGAAGCGCCTCGACGCCGGGGACACCGTCTCCTTCTGCCGCGGCGCCGCCGAGGCCACC
CGCGACCGCCTCTTCATCGACTGGAAGCGCCGCGCCGACGTCCGCGACCCGCACCGCTTC
CAGCGCCTACCGCTCCCCATGACCTCGCCCTACGGCCCGTGGGGCGGCGGCGCGGGCGCT
TCTTCATgccgcccgcgccgcccgccacgctctacgagcatcaccgctttcgccagggct
tcgacttccgcaacatcaaccccgctgtgccggcgaggcagctcgtcttcttcggctccc
cagggacggggattcatcagcacccgcccttgccaccgccgccgtcgccacctccgcctc
ctcaccAACTCCACATTACGGTGCACCACCCGAGCCCCGTAG

Protein

294 aa

>Os04t0581400-01 B3 DNA binding domain containing protein, Brassinosteroid homeostasis
MEQEQDEEEEEAEASPREIPFMTSAAAAATASSSSPTSVSPSATASAAASTSASGSPFRS
SDGAGASGSGGGGGGEDVEVIEKEHMFDKVVTPSDVGKLNRLVIPKQHAEKYFPLDSAAN
EKGLLLSFEDRTGKLWRFRYSYWNSSQSYVMTKGWSRFVKEKRLDAGDTVSFCRGAAEAT
RDRLFIDWKRRADVRDPHRFQRLPLPMTSPYGPWGGGAGASSCRPRRPPRSTSITAFARA
STSATSTPLCRRGSSSSSAPQGRGFISTRPCHRRRRHLRLLTNSTLRCTTRAP*

CDS

chr04:29367030..29367911 (- strand) : 882 bp

3'UTR

chr04:29366459..29367029 (- strand) : 571 bp

FASTA

>Os04t0581400-01 class=Sequence position=chr04:29366459..29367911 (- strand)
ATGGAGCAGG AGCAGGATGA AGAGGAGGAG GAGGCGGAGG CCTCGCCCCG CGAGATCCCC TTCATGACGT CGGCGGCGGC
GGCGGCCACC GCCTCATCGT CCTCCCCGAC ATCGGTCTCC CCTTCCGCCA CCGCTTCcgc ggcggcgtcc acgtcggcgt
cgggctctcc cttccggtcg agcgacggtg cgggagcgtc ggggagtggc ggcggcggtg gcggcgagga cgtggaggtg
atcgagaagg agcacatgtt cgacaaggtg gtgacgccga gcgacgtggg gaagctgaac cggctggtga tcccgaagca
gcacgccgag aagtacttcc cgctggactc ggcggcgaac gagaagggcC TTCTCCTCAG CTTCGAGGAC CGAACCGGCA
AGCTATGGCG CTTCCGCTAC TCCTACTGGA ACAGCAGCCA GAGCTACGTC ATGACCAAGG GTTGGAGCCG CTTCGTCAAG
GAGAAGCGCC TCGACGCCGG GGACACCGTC TCCTTCTGCC GCGGCGCCGC CGAGGCCACC CGCGACCGCC TCTTCATCGA
CTGGAAGCGC CGCGCCGACG TCCGCGACCC GCACCGCTTC CAGCGCCTAC CGCTCCCCAT GACCTCGCCC TACGGCCCGT
GGGGCGGCGG CGCGGGCGCT TCTTCATgcc gcccgcgccg cccgccacgc tctacgagca tcaccgcttt cgccagggct
tcgacttccg caacatcaac cccgctgtgc cggcgaggca gctcgtcttc ttcggctccc cagggacggg gattcatcag
cacccgccct tgccaccgcc gccgtcgcca cctccgcctc ctcaccAACT CCACATTACG GTGCACCACC CGAGCCCCGT
AGTCACCGCC GGCCTGCCCA TGGTTGTCGA CTCGGTGCCG CACGTCAACA ACCCAGCGGC GGCATCGAAG CGCGTCCGGC
TGTTCGGAGT CAACCTCGAT AACCCACATC CGGACGGCGG CCAGTCGTCG AGCGGCCACG ACGCCAATGC ATTGTCGCTA
CGGATGCCCG GGTGGCAAAG GCCTGCACCA TTGAGGTCGC TGGAATTGCC TCCACACATG CCGGCTGGTG CAGCTGGAGC
GGAGTCCTCT GCCGCGTCGT CGCCGTCGTC ATCGTCGTCA TCCAAGAGAG AGGCGCACTC CTCGTTGGAT CTCGATCTGT
GAAGGAGGGA TCAGGCCACC TCGATCGATC GGGAGCGTAC CAAAGGAAAG TTCAAAAAAT CCATCTTCCG TCTGCTGCCT
TCTTCTACTT CTCCACCTTT TGCAATTCTC CATCATAACT TTGATCATAG AGTTAGCATA ACTTTTGGTT TCCTTTTTTG
TTTTTGGCCA TTCACATTCT TATGTTTGTT TGAGAATATA TAGAGAAAAA TTAGGCGAAT TAATGAATTA TTAATGTTTT
TATTTGGGTT TAG