Os04t0583500-02

Locus

Os04g0583500

Description

Similar to Expansin-A10.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

EXPA10

CGSNL Gene Name

ALPHA-EXPANSIN 10

Oryzabase Gene Symbol Synonym(s)

OsEXPA10, OsEXP10, osaEXPa1.28

Oryzabase Gene Name Synonym(s)

Expansin-A10

Transcript Evidence

AK066414 (DDBJ, Best hit)

Protein Evidence

Q7XUD0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: plant-type cell wall organization (GO:0009664)

Cellular Component: extracellular region (GO:0005576)

Functional domain (InterPro)

Expansin (IPR002963)

Expansin/pollen allergen, DPBB domain (IPR007112)

Expansin/Lol pI (IPR007118)

Barwin-related endoglucanase (IPR009009)

Barwin-like endoglucanase (IPR014733)

Full-length cDNA

J013067I11 (Online Clone Ordering)

Expression Databases

TENOR (Os04t0583500-02)

RiceXPro (AK066414)

Others

Oryzabase (9372)

KEGG (Os04t0583500-02)

Transcript

3104 bp

>Os04t0583500-02 Similar to Expansin-A10.
ACTATAGCCAAAGCAATTCACACTCGCACGGGCTCGAGACGGCAGCACAGCTCCACTCCA
CTCCACTCTCCCCCACCACACCACACTGCACTGAGGCATACCGACGAACACCTTTGGAGC
CATGGCTCCCTGCCTCCTCCTCGTCCTCTTCCTCCTCCCGGCGCTCGCCACCGGCCACCA
GCACCCGTCCACCCTCGGCTCCTCCGCCCTCTCCGAGTGGCGCTCCGCCAAGGCCTCCTA
CTACGCCGCCGACCCGGAAGACGCCATCGGTGGCGCGTGCGGGTTCGGGGATCTGGGGAA
GCACGGGTACGGGATGGCGACGGTGGGGCTGAGCACGGCGCTGTTCGAGCGCGGCGCGGC
GTGCGGCGGCTGCTACGAGGTGAAGTGCGTGGATGACCTCAAGTACTGCCTCCCCGGAAC
CTCCATCGTCGTCACGGCCACCAACTTCTGCGCCCCGAACTTCGGTCTCCCCGCCGACGC
CGGCGGCGTCTGCAACCCGCCCAACCACCATTTCCTCCTCCCCATCCAGTCCTTCGAGAA
GATTGCGCTCTGGAAGGCCGGCGTGATGCCCATCCAGTACCGCCGGTACGTTCGATTCTT
GGCTGCATCCTTTGATTGCTGCTATCTTTAGTCTACTTTGCACTGGATTCTAGACTAGAT
CTGAGGTTTATGTTTCCCATTTTCTTAATCCACTTTGTGTGGAAATGTGAAAGTGCTTAG
AATTGCGTCGGTTGGTAGAATGTGGGATCCCAGAAAAGCTGAATTATAAGTGGCCGTTGT
GGAGGAAAGGAAATGGGCCGTCTTCCAATACGGTCAACTTCTGTTAgagcacccgcaatg
gtaaagtaaggtgctctctataaaacatgtacatctcagcaatagactagattaatagta
aaccacctcaatagtatgtctacatgggtatctatagctctctaatgcattgcctcgttt
ttctctatagactatctccaggttagtagatagctttgctctctctcttcatttaatctc
ttcaatgtaggaaaatatgctgacatagatatcttgtagagagcctatagataaccattg
cgggtgcccTTAGGGTTCAGTTGGATAGTTTCATGGTCCTTTATGCTGTAGTGTGTTTAG
GTGTCTAGGTTAGGAGAAAAAAGGGCAGTACTTTTAAAGCCTTCAGCCATTTGATGCACC
ATTTTCGTAAGTACTGTTAGAGTTCTAACTGTTTCAGTTGATTTGCTTCTGGCTCAGCAG
CACAAGAAACTGGTTTCCAAAAAAAAAAAGCAGCACAAGAAACTTGGTGTATGCTTCAGT
TAAAAATTCATATAGTTTGGAATAATATTTTGCTGGTTGGAATTAAAACGATGCAACTTA
CATGCACCATTGATCAGAAAACTAGCAGTAACTTACTATTGTCATCTAAATGTCGCTCGT
GAGAATTCATTTATTCCATTACTCTACTAGTTTAAGGTTGCTAGCTAGAATCCGGAGGCT
GTGAGCTATGGACCTGCAGGTAACAGCAACTCACACCGAATTTATGCAAACAGCCTTCCT
CATATCTGAGTTAGTTTACGAGGTTTTCCCAGGCTAATCCTAATAATCAAGACTCAAAAG
TACACAGTTCTGGGTAATTTCCAGCAGTTTTTTTAATCTGTATCGGTAGGCACTAAGGAA
TGTTAGTCTGCTCCATTACATAGACCGTTTTCCATCACGCTTAATTCCTTTCTGGGGTAC
ATTAGATGTTCCTTTAAGCTTTCAATGACCACTAAGTTAGTCCCACAGGTTGAATTGCTG
CATTATTTGTGGACTGTAGCTGTCCTTAATTTGCTTTCTGTACTAGCAATTTATACCGGT
TGGTATGTCTTTCAAGTCCTTCAATAATTTGATCTGTTATCAAAACTAAAATAGTGTTAA
ACAGATCAGTTCATAGTCAGGCATTATCTTTTCCTGCACTAGATTTTTCTTCACATCTTA
GTGCTCTAGATCTAAATAGGTTACAATCTTCCAGTTGACGTCTGTAAATTAGTGTACGTC
ATTTCTAGTAATATTCAAGAATTAATTTTACGAACCCCCTAATGTGATGCTGAATTAGGT
TGCCTGTATTACTTTCTCAAATATTCTGAGGTATAGTTGAGTAATGCAATATCCATTATG
TGCGTTTAAGTTGGCATCAAATGTGCGTCTAAGTTGGCATCAATTAGATGTTCAACTTCA
AGATGGTTTCCTGAATATCATACTGTCATATTTATGTGCCTATCATACTTCCTCAAGATC
GATGTTCCAGGACATTTTGTAGAGAACATCAACCTGCAGCGCTTTTAAATTATTTCAGGC
TTCACCATATGTTACAGGGCTCAGTTGTTGGCAGGATTTCCATGAGAGTGACAATCTGTT
TGAACGGATTGTTTCACTGAGCAGTGAACCATCACAAGGACAGCTGTACAAGGCTATCAG
TAACATGATAGCCTGTAGATAGAAAGCAAAATTATTGTAGATTGTAAATTGGTCAGCAAA
AATTGTCAATTGTCACTAATCTTGGCGTGTTTAATTTGTATGCAGCGTCAACTGTCTTCG
TGATGGTGGTGTGCGATTCGCAGTCGCTGGTCGAAGCTTCTTCCTGACAGTCCTAATTAG
CAATGTCGGTGGTGCTGGCGATGTCCGATCAGTGAAGATCAAAGGAACGGAGTCCGGTTG
GCTCTCGATGGGCCGCAACTGGGGGCAGATATGGCACATCAACTCTGATTTCAGGGGACA
GCCTCTCTCCTTCGAGCTCACCTCAAGTGATGGAAAAACATTGACCAACTACAACGTGGT
CCCTAAGGAGTGGGACTTCGGCAAAACATACACTGGCAAGCAGTTCCTGCTCTAGAGAGG
AAAGGGTACCAATAGCAGCTTACAGTTACAAATTTTTTTCTGATCCTATGAGTTGGATTG
TACTATTGTATATTCCTCTGAGGAACGATAATAGTATCATTAGAGAAAGAAATGTTTAGT
GCAGAGCCTCCAATAGTAGTCCAACATAGAAAAGGTGCTCATAAATGTGGCATGTACCAT
TTGGAACTCTGATAATTGCACTACAGAGGCTTGATGTACCATTC

CDS

510 bp

>Os04t0583500-02 Similar to Expansin-A10.
ATGGCTCCCTGCCTCCTCCTCGTCCTCTTCCTCCTCCCGGCGCTCGCCACCGGCCACCAG
CACCCGTCCACCCTCGGCTCCTCCGCCCTCTCCGAGTGGCGCTCCGCCAAGGCCTCCTAC
TACGCCGCCGACCCGGAAGACGCCATCGGTGGCGCGTGCGGGTTCGGGGATCTGGGGAAG
CACGGGTACGGGATGGCGACGGTGGGGCTGAGCACGGCGCTGTTCGAGCGCGGCGCGGCG
TGCGGCGGCTGCTACGAGGTGAAGTGCGTGGATGACCTCAAGTACTGCCTCCCCGGAACC
TCCATCGTCGTCACGGCCACCAACTTCTGCGCCCCGAACTTCGGTCTCCCCGCCGACGCC
GGCGGCGTCTGCAACCCGCCCAACCACCATTTCCTCCTCCCCATCCAGTCCTTCGAGAAG
ATTGCGCTCTGGAAGGCCGGCGTGATGCCCATCCAGTACCGCCGGTACGTTCGATTCTTG
GCTGCATCCTTTGATTGCTGCTATCTTTAG

Protein

170 aa

>Os04t0583500-02 Similar to Expansin-A10.
MAPCLLLVLFLLPALATGHQHPSTLGSSALSEWRSAKASYYAADPEDAIGGACGFGDLGK
HGYGMATVGLSTALFERGAACGGCYEVKCVDDLKYCLPGTSIVVTATNFCAPNFGLPADA
GGVCNPPNHHFLLPIQSFEKIALWKAGVMPIQYRRYVRFLAASFDCCYL*

5'UTR

chr04:29485142..29485262 (+ strand) : 121 bp

CDS

chr04:29485263..29485410 (+ strand) : 148 bp

chr04:29485685..29486046 (+ strand) : 362 bp

3'UTR

chr04:29486047..29488519 (+ strand) : 2473 bp

FASTA

>Os04t0583500-02 class=Sequence position=chr04:29485142..29488519 (+ strand)
ACTATAGCCA AAGCAATTCA CACTCGCACG GGCTCGAGAC GGCAGCACAG CTCCACTCCA CTCCACTCTC CCCCACCACA
CCACACTGCA CTGAGGCATA CCGACGAACA CCTTTGGAGC CATGGCTCCC TGCCTCCTCC TCGTCCTCTT CCTCCTCCCG
GCGCTCGCCA CCGGCCACCA GCACCCGTCC ACCCTCGGCT CCTCCGCCCT CTCCGAGTGG CGCTCCGCCA AGGCCTCCTA
CTACGCCGCC GACCCGGAAG ACGCCATCGG TACGCATCCA AAGCTAGCTG GCTCTCTTTG GTCATCTCTG CATCTAGGAA
CGAATCTGTC CTTGCGCTTC TTTAATTCTC CATAACTACC CCTAAGGCCA TGGAAGATTT CTCTTCCCGC ATGTCCCGCG
GACGAAATTT CCCTCAAAGC CGCACGCTCG GTTACTTGAA TTATCTGCGC GTACGGTTGG TTCTTGAATT GGTTGCTTCC
TCTATCATGG TTTCATCCGT AGGAGCGTGC TTGATTTGTG CCGTGCTGTT GGGCGGATTA CAGGTGGCGC GTGCGGGTTC
GGGGATCTGG GGAAGCACGG GTACGGGATG GCGACGGTGG GGCTGAGCAC GGCGCTGTTC GAGCGCGGCG CGGCGTGCGG
CGGCTGCTAC GAGGTGAAGT GCGTGGATGA CCTCAAGTAC TGCCTCCCCG GAACCTCCAT CGTCGTCACG GCCACCAACT
TCTGCGCCCC GAACTTCGGT CTCCCCGCCG ACGCCGGCGG CGTCTGCAAC CCGCCCAACC ACCATTTCCT CCTCCCCATC
CAGTCCTTCG AGAAGATTGC GCTCTGGAAG GCCGGCGTGA TGCCCATCCA GTACCGCCGG TACGTTCGAT TCTTGGCTGC
ATCCTTTGAT TGCTGCTATC TTTAGTCTAC TTTGCACTGG ATTCTAGACT AGATCTGAGG TTTATGTTTC CCATTTTCTT
AATCCACTTT GTGTGGAAAT GTGAAAGTGC TTAGAATTGC GTCGGTTGGT AGAATGTGGG ATCCCAGAAA AGCTGAATTA
TAAGTGGCCG TTGTGGAGGA AAGGAAATGG GCCGTCTTCC AATACGGTCA ACTTCTGTTA gagcacccgc aatggtaaag
taaggtgctc tctataaaac atgtacatct cagcaataga ctagattaat agtaaaccac ctcaatagta tgtctacatg
ggtatctata gctctctaat gcattgcctc gtttttctct atagactatc tccaggttag tagatagctt tgctctctct
cttcatttaa tctcttcaat gtaggaaaat atgctgacat agatatcttg tagagagcct atagataacc attgcgggtg
cccTTAGGGT TCAGTTGGAT AGTTTCATGG TCCTTTATGC TGTAGTGTGT TTAGGTGTCT AGGTTAGGAG AAAAAAGGGC
AGTACTTTTA AAGCCTTCAG CCATTTGATG CACCATTTTC GTAAGTACTG TTAGAGTTCT AACTGTTTCA GTTGATTTGC
TTCTGGCTCA GCAGCACAAG AAACTGGTTT CCAAAAAAAA AAAGCAGCAC AAGAAACTTG GTGTATGCTT CAGTTAAAAA
TTCATATAGT TTGGAATAAT ATTTTGCTGG TTGGAATTAA AACGATGCAA CTTACATGCA CCATTGATCA GAAAACTAGC
AGTAACTTAC TATTGTCATC TAAATGTCGC TCGTGAGAAT TCATTTATTC CATTACTCTA CTAGTTTAAG GTTGCTAGCT
AGAATCCGGA GGCTGTGAGC TATGGACCTG CAGGTAACAG CAACTCACAC CGAATTTATG CAAACAGCCT TCCTCATATC
TGAGTTAGTT TACGAGGTTT TCCCAGGCTA ATCCTAATAA TCAAGACTCA AAAGTACACA GTTCTGGGTA ATTTCCAGCA
GTTTTTTTAA TCTGTATCGG TAGGCACTAA GGAATGTTAG TCTGCTCCAT TACATAGACC GTTTTCCATC ACGCTTAATT
CCTTTCTGGG GTACATTAGA TGTTCCTTTA AGCTTTCAAT GACCACTAAG TTAGTCCCAC AGGTTGAATT GCTGCATTAT
TTGTGGACTG TAGCTGTCCT TAATTTGCTT TCTGTACTAG CAATTTATAC CGGTTGGTAT GTCTTTCAAG TCCTTCAATA
ATTTGATCTG TTATCAAAAC TAAAATAGTG TTAAACAGAT CAGTTCATAG TCAGGCATTA TCTTTTCCTG CACTAGATTT
TTCTTCACAT CTTAGTGCTC TAGATCTAAA TAGGTTACAA TCTTCCAGTT GACGTCTGTA AATTAGTGTA CGTCATTTCT
AGTAATATTC AAGAATTAAT TTTACGAACC CCCTAATGTG ATGCTGAATT AGGTTGCCTG TATTACTTTC TCAAATATTC
TGAGGTATAG TTGAGTAATG CAATATCCAT TATGTGCGTT TAAGTTGGCA TCAAATGTGC GTCTAAGTTG GCATCAATTA
GATGTTCAAC TTCAAGATGG TTTCCTGAAT ATCATACTGT CATATTTATG TGCCTATCAT ACTTCCTCAA GATCGATGTT
CCAGGACATT TTGTAGAGAA CATCAACCTG CAGCGCTTTT AAATTATTTC AGGCTTCACC ATATGTTACA GGGCTCAGTT
GTTGGCAGGA TTTCCATGAG AGTGACAATC TGTTTGAACG GATTGTTTCA CTGAGCAGTG AACCATCACA AGGACAGCTG
TACAAGGCTA TCAGTAACAT GATAGCCTGT AGATAGAAAG CAAAATTATT GTAGATTGTA AATTGGTCAG CAAAAATTGT
CAATTGTCAC TAATCTTGGC GTGTTTAATT TGTATGCAGC GTCAACTGTC TTCGTGATGG TGGTGTGCGA TTCGCAGTCG
CTGGTCGAAG CTTCTTCCTG ACAGTCCTAA TTAGCAATGT CGGTGGTGCT GGCGATGTCC GATCAGTGAA GATCAAAGGA
ACGGAGTCCG GTTGGCTCTC GATGGGCCGC AACTGGGGGC AGATATGGCA CATCAACTCT GATTTCAGGG GACAGCCTCT
CTCCTTCGAG CTCACCTCAA GTGATGGAAA AACATTGACC AACTACAACG TGGTCCCTAA GGAGTGGGAC TTCGGCAAAA
CATACACTGG CAAGCAGTTC CTGCTCTAGA GAGGAAAGGG TACCAATAGC AGCTTACAGT TACAAATTTT TTTCTGATCC
TATGAGTTGG ATTGTACTAT TGTATATTCC TCTGAGGAAC GATAATAGTA TCATTAGAGA AAGAAATGTT TAGTGCAGAG
CCTCCAATAG TAGTCCAACA TAGAAAAGGT GCTCATAAAT GTGGCATGTA CCATTTGGAA CTCTGATAAT TGCACTACAG
AGGCTTGATG TACCATTC